| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:EHD1-BATF2 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: EHD1-BATF2 | FusionPDB ID: 25548 | FusionGDB2.0 ID: 25548 | Hgene | Tgene | Gene symbol | EHD1 | BATF2 | Gene ID | 10938 | 116071 |
| Gene name | EH domain containing 1 | basic leucine zipper ATF-like transcription factor 2 | |
| Synonyms | H-PAST|HPAST1|PAST|PAST1 | SARI | |
| Cytomap | 11q13.1 | 11q13.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | EH domain-containing protein 1PAST homolog 1testilin | basic leucine zipper transcriptional factor ATF-like 2B-ATF-2basic leucine zipper transcription factor, ATF-like 2suppressor of AP-1 regulated by IFN | |
| Modification date | 20200329 | 20200313 | |
| UniProtAcc | Q9H4M9 | Q8N1L9 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000320631, ENST00000359393, ENST00000488711, | ENST00000435842, ENST00000527716, ENST00000301887, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 6 X 7 X 6=252 | 3 X 2 X 4=24 |
| # samples | 8 | 4 | |
| ** MAII score | log2(8/252*10)=-1.65535182861255 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/24*10)=0.736965594166206 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: EHD1 [Title/Abstract] AND BATF2 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | EHD1(64641893)-BATF2(64757284), # samples:3 EHD1(64641893)-BATF2(64762021), # samples:3 | ||
| Anticipated loss of major functional domain due to fusion event. | EHD1-BATF2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. EHD1-BATF2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. EHD1-BATF2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. EHD1-BATF2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. EHD1-BATF2 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. EHD1-BATF2 seems lost the major protein functional domain in Tgene partner, which is a transcription factor due to the frame-shifted ORF. EHD1-BATF2 seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Fusion gene breakpoints across EHD1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across BATF2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | LUAD | TCGA-44-6778-01A | EHD1 | chr11 | 64641893 | - | BATF2 | chr11 | 64757284 | - |
| ChimerDB4 | PRAD | TCGA-YL-A9WK-01A | EHD1 | chr11 | 64641893 | - | BATF2 | chr11 | 64762021 | - |
| ChimerDB4 | PRAD | TCGA-YL-A9WK | EHD1 | chr11 | 64641893 | - | BATF2 | chr11 | 64762021 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000359393 | EHD1 | chr11 | 64641893 | - | ENST00000301887 | BATF2 | chr11 | 64757284 | - | 2783 | 913 | 724 | 1596 | 290 |
| ENST00000359393 | EHD1 | chr11 | 64641893 | - | ENST00000301887 | BATF2 | chr11 | 64762021 | - | 2885 | 913 | 724 | 1698 | 324 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000359393 | ENST00000301887 | EHD1 | chr11 | 64641893 | - | BATF2 | chr11 | 64757284 | - | 0.32784036 | 0.6721596 |
| ENST00000359393 | ENST00000301887 | EHD1 | chr11 | 64641893 | - | BATF2 | chr11 | 64762021 | - | 0.021552581 | 0.9784474 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >25548_25548_1_EHD1-BATF2_EHD1_chr11_64641893_ENST00000359393_BATF2_chr11_64757284_ENST00000301887_length(amino acids)=290AA_BP=56 MRAWCRATRSWWTRGAPSASSTRLATLSSTGSCVPSCPTPSWTASASSTPPGSCLERSSGSAEQHESLEKDNLALRKEIQSLQAELAWWS RTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVA EPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVV -------------------------------------------------------------- >25548_25548_2_EHD1-BATF2_EHD1_chr11_64641893_ENST00000359393_BATF2_chr11_64762021_ENST00000301887_length(amino acids)=324AA_BP=63 MRAWCRATRSWWTRGAPSASSTRLATLSSTGSCVPSCPTPSWTASASSTPPGSCLERSSGSAEDPKEQQRQLKKQKNRAAAQRSRQKHTD KADALHQQHESLEKDNLALRKEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSC YPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLG -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr11:64641893/chr11:64757284) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| EHD1 | BATF2 |
| FUNCTION: ATP- and membrane-binding protein that controls membrane reorganization/tubulation upon ATP hydrolysis. In vitro causes vesiculation of endocytic membranes (PubMed:24019528). Acts in early endocytic membrane fusion and membrane trafficking of recycling endosomes (PubMed:15020713, PubMed:17233914, PubMed:20801876). Recruited to endosomal membranes upon nerve growth factor stimulation, indirectly regulates neurite outgrowth (By similarity). Plays a role in myoblast fusion (By similarity). Involved in the unidirectional retrograde dendritic transport of endocytosed BACE1 and in efficient sorting of BACE1 to axons implicating a function in neuronal APP processing (By similarity). Plays a role in the formation of the ciliary vesicle (CV), an early step in cilium biogenesis. Proposed to be required for the fusion of distal appendage vesicles (DAVs) to form the CV by recruiting SNARE complex component SNAP29. Is required for recruitment of transition zone proteins CEP290, RPGRIP1L, TMEM67 and B9D2, and of IFT20 following DAV reorganization before Rab8-dependent ciliary membrane extension. Required for the loss of CCP110 form the mother centriole essential for the maturation of the basal body during ciliogenesis (PubMed:25686250). {ECO:0000250|UniProtKB:Q641Z6, ECO:0000250|UniProtKB:Q9WVK4, ECO:0000269|PubMed:15020713, ECO:0000269|PubMed:17233914, ECO:0000269|PubMed:20801876, ECO:0000269|PubMed:24019528, ECO:0000269|PubMed:25686250}. | FUNCTION: AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system. Following infection, participates in the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes (By similarity). Selectively suppresses CCN1 transcription and hence blocks the downstream cell proliferation signals produced by CCN1 and inhibits CCN1-induced anchorage-independent growth and invasion in several cancer types, such as breast cancer, malignant glioma and metastatic melanoma. Possibly acts by interfering with AP-1 binding to CCN1 promoter. {ECO:0000250, ECO:0000269|PubMed:20531301}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000320631 | - | 2 | 5 | 153_156 | 167.33333333333334 | 535.0 | Region | G3 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000320631 | - | 2 | 5 | 65_72 | 167.33333333333334 | 535.0 | Region | G1 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000320631 | - | 2 | 5 | 91_92 | 167.33333333333334 | 535.0 | Region | G2 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000359393 | - | 4 | 7 | 153_156 | 167.33333333333334 | 535.0 | Region | G3 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000359393 | - | 4 | 7 | 65_72 | 167.33333333333334 | 535.0 | Region | G1 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000359393 | - | 4 | 7 | 91_92 | 167.33333333333334 | 535.0 | Region | G2 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000320631 | - | 2 | 5 | 153_156 | 167.33333333333334 | 535.0 | Region | G3 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000320631 | - | 2 | 5 | 65_72 | 167.33333333333334 | 535.0 | Region | G1 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000320631 | - | 2 | 5 | 91_92 | 167.33333333333334 | 535.0 | Region | G2 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000359393 | - | 4 | 7 | 153_156 | 167.33333333333334 | 535.0 | Region | G3 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000359393 | - | 4 | 7 | 65_72 | 167.33333333333334 | 535.0 | Region | G1 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000359393 | - | 4 | 7 | 91_92 | 167.33333333333334 | 535.0 | Region | G2 motif |
| Tgene | BATF2 | chr11:64641893 | chr11:64757284 | ENST00000435842 | 0 | 2 | 17_80 | 0 | 190.0 | Domain | bZIP | |
| Tgene | BATF2 | chr11:64641893 | chr11:64762021 | ENST00000301887 | 0 | 3 | 17_80 | 13.0 | 275.0 | Domain | bZIP | |
| Tgene | BATF2 | chr11:64641893 | chr11:64762021 | ENST00000435842 | 0 | 2 | 17_80 | 0 | 190.0 | Domain | bZIP | |
| Tgene | BATF2 | chr11:64641893 | chr11:64757284 | ENST00000301887 | 1 | 3 | 45_66 | 47.0 | 275.0 | Region | Leucine-zipper | |
| Tgene | BATF2 | chr11:64641893 | chr11:64757284 | ENST00000435842 | 0 | 2 | 20_41 | 0 | 190.0 | Region | Basic motif | |
| Tgene | BATF2 | chr11:64641893 | chr11:64757284 | ENST00000435842 | 0 | 2 | 45_66 | 0 | 190.0 | Region | Leucine-zipper | |
| Tgene | BATF2 | chr11:64641893 | chr11:64762021 | ENST00000301887 | 0 | 3 | 20_41 | 13.0 | 275.0 | Region | Basic motif | |
| Tgene | BATF2 | chr11:64641893 | chr11:64762021 | ENST00000301887 | 0 | 3 | 45_66 | 13.0 | 275.0 | Region | Leucine-zipper | |
| Tgene | BATF2 | chr11:64641893 | chr11:64762021 | ENST00000435842 | 0 | 2 | 20_41 | 0 | 190.0 | Region | Basic motif | |
| Tgene | BATF2 | chr11:64641893 | chr11:64762021 | ENST00000435842 | 0 | 2 | 45_66 | 0 | 190.0 | Region | Leucine-zipper |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000320631 | - | 2 | 5 | 489_500 | 167.33333333333334 | 535.0 | Calcium binding | Ontology_term=ECO:0000269,ECO:0007744,ECO:0007744 |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000359393 | - | 4 | 7 | 489_500 | 167.33333333333334 | 535.0 | Calcium binding | Ontology_term=ECO:0000269,ECO:0007744,ECO:0007744 |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000320631 | - | 2 | 5 | 489_500 | 167.33333333333334 | 535.0 | Calcium binding | Ontology_term=ECO:0000269,ECO:0007744,ECO:0007744 |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000359393 | - | 4 | 7 | 489_500 | 167.33333333333334 | 535.0 | Calcium binding | Ontology_term=ECO:0000269,ECO:0007744,ECO:0007744 |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000320631 | - | 2 | 5 | 198_227 | 167.33333333333334 | 535.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000359393 | - | 4 | 7 | 198_227 | 167.33333333333334 | 535.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000320631 | - | 2 | 5 | 198_227 | 167.33333333333334 | 535.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000359393 | - | 4 | 7 | 198_227 | 167.33333333333334 | 535.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000320631 | - | 2 | 5 | 444_532 | 167.33333333333334 | 535.0 | Domain | EH |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000320631 | - | 2 | 5 | 476_511 | 167.33333333333334 | 535.0 | Domain | EF-hand |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000320631 | - | 2 | 5 | 55_286 | 167.33333333333334 | 535.0 | Domain | Dynamin-type G |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000359393 | - | 4 | 7 | 444_532 | 167.33333333333334 | 535.0 | Domain | EH |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000359393 | - | 4 | 7 | 476_511 | 167.33333333333334 | 535.0 | Domain | EF-hand |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000359393 | - | 4 | 7 | 55_286 | 167.33333333333334 | 535.0 | Domain | Dynamin-type G |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000320631 | - | 2 | 5 | 444_532 | 167.33333333333334 | 535.0 | Domain | EH |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000320631 | - | 2 | 5 | 476_511 | 167.33333333333334 | 535.0 | Domain | EF-hand |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000320631 | - | 2 | 5 | 55_286 | 167.33333333333334 | 535.0 | Domain | Dynamin-type G |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000359393 | - | 4 | 7 | 444_532 | 167.33333333333334 | 535.0 | Domain | EH |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000359393 | - | 4 | 7 | 476_511 | 167.33333333333334 | 535.0 | Domain | EF-hand |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000359393 | - | 4 | 7 | 55_286 | 167.33333333333334 | 535.0 | Domain | Dynamin-type G |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000320631 | - | 2 | 5 | 219_222 | 167.33333333333334 | 535.0 | Region | G4 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000320631 | - | 2 | 5 | 243_243 | 167.33333333333334 | 535.0 | Region | G5 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000359393 | - | 4 | 7 | 219_222 | 167.33333333333334 | 535.0 | Region | G4 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64757284 | ENST00000359393 | - | 4 | 7 | 243_243 | 167.33333333333334 | 535.0 | Region | G5 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000320631 | - | 2 | 5 | 219_222 | 167.33333333333334 | 535.0 | Region | G4 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000320631 | - | 2 | 5 | 243_243 | 167.33333333333334 | 535.0 | Region | G5 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000359393 | - | 4 | 7 | 219_222 | 167.33333333333334 | 535.0 | Region | G4 motif |
| Hgene | EHD1 | chr11:64641893 | chr11:64762021 | ENST00000359393 | - | 4 | 7 | 243_243 | 167.33333333333334 | 535.0 | Region | G5 motif |
| Tgene | BATF2 | chr11:64641893 | chr11:64757284 | ENST00000301887 | 1 | 3 | 17_80 | 47.0 | 275.0 | Domain | bZIP | |
| Tgene | BATF2 | chr11:64641893 | chr11:64757284 | ENST00000301887 | 1 | 3 | 20_41 | 47.0 | 275.0 | Region | Basic motif |
Top |
Fusion Protein Structures |
| PDB and CIF files of the predicted fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
| PDB file >>>599_EHD1_64641893_BATF2_64762021_ranked_0.pdb | EHD1 | 64641893 | 64641893 | ENST00000301887 | BATF2 | chr11 | 64762021 | - | MRAWCRATRSWWTRGAPSASSTRLATLSSTGSCVPSCPTPSWTASASSTPPGSCLERSSGSAEDPKEQQRQLKKQKNRAAAQRSRQKHTD KADALHQQHESLEKDNLALRKEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSC YPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLG | 324 |
Top |
pLDDT score distribution |
| pLDDT score distribution of the predicted wild-type structures of two partner proteins from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
EHD1_pLDDT.png  |
BATF2_pLDDT.png  |
| pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
 |
Top |
Ramachandran Plot of Fusion Protein Structure |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| EHD1 | |
| BATF2 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to EHD1-BATF2 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to EHD1-BATF2 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies