UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:FA2H-KARS |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: FA2H-KARS | FusionPDB ID: 28174 | FusionGDB2.0 ID: 28174 | Hgene | Tgene | Gene symbol | FA2H | KARS | Gene ID | 79152 | 3735 |
Gene name | fatty acid 2-hydroxylase | lysyl-tRNA synthetase 1 | |
Synonyms | FAAH|FAH1|FAXDC1|SCS7|SPG35 | CMTRIB|DFNB89|KARS|KARS2|KRS | |
Cytomap | 16q23.1 | 16q23.1 | |
Type of gene | protein-coding | protein-coding | |
Description | fatty acid 2-hydroxylasefatty acid alpha-hydroxylasefatty acid hydroxylase domain containing 1spastic paraplegia 35 (autosomal recessive) | lysine--tRNA ligaselysRSlysine tRNA ligase | |
Modification date | 20200313 | 20200318 | |
UniProtAcc | Q7L5A8 | Q15046 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000219368, ENST00000544337, | ENST00000568378, ENST00000302445, ENST00000319410, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 4 X 4 X 3=48 | 7 X 7 X 4=196 |
# samples | 5 | 9 | |
** MAII score | log2(5/48*10)=0.0588936890535686 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(9/196*10)=-1.12285674778553 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: FA2H [Title/Abstract] AND KARS [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | FA2H(74773921)-KARS(75665753), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | FA2H-KARS seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. FA2H-KARS seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. FA2H-KARS seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. FA2H-KARS seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | FA2H | GO:0046513 | ceramide biosynthetic process | 15337768 |
Tgene | KARS | GO:0000187 | activation of MAPK activity | 15851690 |
Tgene | KARS | GO:0002741 | positive regulation of cytokine secretion involved in immune response | 15851690 |
Tgene | KARS | GO:0006430 | lysyl-tRNA aminoacylation | 9278442|10952987|23159739 |
Tgene | KARS | GO:0008285 | negative regulation of cell proliferation | 15851690 |
Tgene | KARS | GO:0010759 | positive regulation of macrophage chemotaxis | 15851690 |
Tgene | KARS | GO:0015966 | diadenosine tetraphosphate biosynthetic process | 23159739 |
Tgene | KARS | GO:0033209 | tumor necrosis factor-mediated signaling pathway | 15851690 |
Tgene | KARS | GO:0043032 | positive regulation of macrophage activation | 15851690 |
Tgene | KARS | GO:0070374 | positive regulation of ERK1 and ERK2 cascade | 15851690 |
Tgene | KARS | GO:1900017 | positive regulation of cytokine production involved in inflammatory response | 15851690 |
Tgene | KARS | GO:1900745 | positive regulation of p38MAPK cascade | 15851690 |
Tgene | KARS | GO:1905050 | positive regulation of metallopeptidase activity | 15851690 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | ESCA | TCGA-L5-A8NE-01A | FA2H | chr16 | 74773921 | - | KARS | chr16 | 75665753 | - |
ChimerDB4 | ESCA | TCGA-L5-A8NE | FA2H | chr16 | 74773920 | - | KARS | chr16 | 75665753 | - |
ChimerDB4 | ESCA | TCGA-L5-A8NE | FA2H | chr16 | 74773921 | - | KARS | chr16 | 75665753 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000219368 | FA2H | chr16 | 74773921 | - | ENST00000319410 | KARS | chr16 | 75665753 | - | 1483 | 433 | 55 | 1311 | 418 |
ENST00000219368 | FA2H | chr16 | 74773921 | - | ENST00000302445 | KARS | chr16 | 75665753 | - | 1483 | 433 | 55 | 1311 | 418 |
ENST00000219368 | FA2H | chr16 | 74773920 | - | ENST00000319410 | KARS | chr16 | 75665753 | - | 1483 | 433 | 55 | 1311 | 418 |
ENST00000219368 | FA2H | chr16 | 74773920 | - | ENST00000302445 | KARS | chr16 | 75665753 | - | 1483 | 433 | 55 | 1311 | 418 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000219368 | ENST00000319410 | FA2H | chr16 | 74773921 | - | KARS | chr16 | 75665753 | - | 0.004534332 | 0.9954657 |
ENST00000219368 | ENST00000302445 | FA2H | chr16 | 74773921 | - | KARS | chr16 | 75665753 | - | 0.004534332 | 0.9954657 |
ENST00000219368 | ENST00000319410 | FA2H | chr16 | 74773920 | - | KARS | chr16 | 75665753 | - | 0.004534332 | 0.9954657 |
ENST00000219368 | ENST00000302445 | FA2H | chr16 | 74773920 | - | KARS | chr16 | 75665753 | - | 0.004534332 | 0.9954657 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >28174_28174_1_FA2H-KARS_FA2H_chr16_74773920_ENST00000219368_KARS_chr16_75665753_ENST00000302445_length(amino acids)=418AA_BP=126 MRSPAMAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGEL RGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVS GMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVG EFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEY -------------------------------------------------------------- >28174_28174_2_FA2H-KARS_FA2H_chr16_74773920_ENST00000219368_KARS_chr16_75665753_ENST00000319410_length(amino acids)=418AA_BP=126 MRSPAMAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGEL RGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVS GMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVG EFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEY -------------------------------------------------------------- >28174_28174_3_FA2H-KARS_FA2H_chr16_74773921_ENST00000219368_KARS_chr16_75665753_ENST00000302445_length(amino acids)=418AA_BP=126 MRSPAMAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGEL RGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVS GMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVG EFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEY -------------------------------------------------------------- >28174_28174_4_FA2H-KARS_FA2H_chr16_74773921_ENST00000219368_KARS_chr16_75665753_ENST00000319410_length(amino acids)=418AA_BP=126 MRSPAMAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGEL RGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVS GMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVG EFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEY -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr16:74773921/chr16:75665753) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
FA2H | KARS |
FUNCTION: Catalyzes the hydroxylation of free fatty acids at the C-2 position to produce 2-hydroxy fatty acids, which are building blocks of sphingolipids and glycosphingolipids common in neural tissue and epidermis (PubMed:15337768, PubMed:15863841, PubMed:17355976, PubMed:22517924). FA2H is stereospecific for the production of (R)-2-hydroxy fatty acids (PubMed:22517924). Plays an essential role in the synthesis of galactosphingolipids of the myelin sheath (By similarity). Responsible for the synthesis of sphingolipids and glycosphingolipids involved in the formation of epidermal lamellar bodies critical for skin permeability barrier (PubMed:17355976). Participates in the synthesis of glycosphingolipids and a fraction of type II wax diesters in sebaceous gland, specifically regulating hair follicle homeostasis (By similarity). Involved in the synthesis of sphingolipids of plasma membrane rafts, controlling lipid raft mobility and trafficking of raft-associated proteins (By similarity). {ECO:0000250|UniProtKB:Q5MPP0, ECO:0000269|PubMed:15337768, ECO:0000269|PubMed:15863841, ECO:0000269|PubMed:17355976, ECO:0000269|PubMed:22517924}. | FUNCTION: Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA (PubMed:9278442, PubMed:18029264, PubMed:18272479). When secreted, acts as a signaling molecule that induces immune response through the activation of monocyte/macrophages (PubMed:15851690). Catalyzes the synthesis of the signaling molecule diadenosine tetraphosphate (Ap4A), and thereby mediates disruption of the complex between HINT1 and MITF and the concomitant activation of MITF transcriptional activity (PubMed:5338216, PubMed:14975237, PubMed:19524539, PubMed:23159739). {ECO:0000269|PubMed:14975237, ECO:0000269|PubMed:15851690, ECO:0000269|PubMed:18029264, ECO:0000269|PubMed:19524539, ECO:0000269|PubMed:28887846, ECO:0000269|PubMed:5338216, ECO:0000269|PubMed:9278442}.; FUNCTION: (Microbial infection) Interacts with HIV-1 virus GAG protein, facilitating the selective packaging of tRNA(3)(Lys), the primer for reverse transcription initiation. {ECO:0000269|PubMed:15220430}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | FA2H | chr16:74773920 | chr16:75665753 | ENST00000219368 | - | 2 | 7 | 8_86 | 121.0 | 373.0 | Domain | Cytochrome b5 heme-binding |
Hgene | FA2H | chr16:74773921 | chr16:75665753 | ENST00000219368 | - | 2 | 7 | 8_86 | 121.0 | 373.0 | Domain | Cytochrome b5 heme-binding |
Tgene | KARS | chr16:74773920 | chr16:75665753 | ENST00000302445 | 6 | 14 | 323_325 | 305.0 | 598.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773920 | chr16:75665753 | ENST00000302445 | 6 | 14 | 331_332 | 305.0 | 598.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773920 | chr16:75665753 | ENST00000302445 | 6 | 14 | 494_495 | 305.0 | 598.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773920 | chr16:75665753 | ENST00000302445 | 6 | 14 | 550_553 | 305.0 | 598.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773920 | chr16:75665753 | ENST00000319410 | 7 | 15 | 331_332 | 333.0 | 626.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773920 | chr16:75665753 | ENST00000319410 | 7 | 15 | 494_495 | 333.0 | 626.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773920 | chr16:75665753 | ENST00000319410 | 7 | 15 | 550_553 | 333.0 | 626.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773921 | chr16:75665753 | ENST00000302445 | 6 | 14 | 323_325 | 305.0 | 598.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773921 | chr16:75665753 | ENST00000302445 | 6 | 14 | 331_332 | 305.0 | 598.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773921 | chr16:75665753 | ENST00000302445 | 6 | 14 | 494_495 | 305.0 | 598.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773921 | chr16:75665753 | ENST00000302445 | 6 | 14 | 550_553 | 305.0 | 598.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773921 | chr16:75665753 | ENST00000319410 | 7 | 15 | 331_332 | 333.0 | 626.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773921 | chr16:75665753 | ENST00000319410 | 7 | 15 | 494_495 | 333.0 | 626.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773921 | chr16:75665753 | ENST00000319410 | 7 | 15 | 550_553 | 333.0 | 626.0 | Nucleotide binding | ATP |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | FA2H | chr16:74773920 | chr16:75665753 | ENST00000219368 | - | 2 | 7 | 219_361 | 121.0 | 373.0 | Domain | Fatty acid hydroxylase |
Hgene | FA2H | chr16:74773921 | chr16:75665753 | ENST00000219368 | - | 2 | 7 | 219_361 | 121.0 | 373.0 | Domain | Fatty acid hydroxylase |
Hgene | FA2H | chr16:74773920 | chr16:75665753 | ENST00000219368 | - | 2 | 7 | 168_188 | 121.0 | 373.0 | Transmembrane | Helical |
Hgene | FA2H | chr16:74773920 | chr16:75665753 | ENST00000219368 | - | 2 | 7 | 213_233 | 121.0 | 373.0 | Transmembrane | Helical |
Hgene | FA2H | chr16:74773920 | chr16:75665753 | ENST00000219368 | - | 2 | 7 | 268_288 | 121.0 | 373.0 | Transmembrane | Helical |
Hgene | FA2H | chr16:74773920 | chr16:75665753 | ENST00000219368 | - | 2 | 7 | 290_310 | 121.0 | 373.0 | Transmembrane | Helical |
Hgene | FA2H | chr16:74773921 | chr16:75665753 | ENST00000219368 | - | 2 | 7 | 168_188 | 121.0 | 373.0 | Transmembrane | Helical |
Hgene | FA2H | chr16:74773921 | chr16:75665753 | ENST00000219368 | - | 2 | 7 | 213_233 | 121.0 | 373.0 | Transmembrane | Helical |
Hgene | FA2H | chr16:74773921 | chr16:75665753 | ENST00000219368 | - | 2 | 7 | 268_288 | 121.0 | 373.0 | Transmembrane | Helical |
Hgene | FA2H | chr16:74773921 | chr16:75665753 | ENST00000219368 | - | 2 | 7 | 290_310 | 121.0 | 373.0 | Transmembrane | Helical |
Tgene | KARS | chr16:74773920 | chr16:75665753 | ENST00000319410 | 7 | 15 | 323_325 | 333.0 | 626.0 | Nucleotide binding | ATP | |
Tgene | KARS | chr16:74773921 | chr16:75665753 | ENST00000319410 | 7 | 15 | 323_325 | 333.0 | 626.0 | Nucleotide binding | ATP |
Top |
Fusion Protein Structures |
![]() * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
PDB file >>>862_FA2H_74773921_KARS_75665753_862_FA2H_74773921_KARS_75665753_ranked_0.pdb | FA2H | 74773920 | 74773921 | ENST00000302445 | KARS | chr16 | 75665753 | - | MRSPAMAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGEL RGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVS GMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVG EFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEY | 418 |
Top |
pLDDT score distribution |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
FA2H_pLDDT.png![]() |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
![]() |
Top |
Ramachandran Plot of Fusion Protein Structure |
![]() |
Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
FA2H | |
KARS |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to FA2H-KARS |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to FA2H-KARS |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |