UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:AGPS-MOB4 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: AGPS-MOB4 | FusionPDB ID: 2981 | FusionGDB2.0 ID: 2985 | Hgene | Tgene | Gene symbol | AGPS | MOB4 | Gene ID | 8540 | 25843 |
Gene name | alkylglycerone phosphate synthase | MOB family member 4, phocein | |
Synonyms | ADAP-S|ADAS|ADHAPS|ADPS|ALDHPSY|RCDP3 | 2C4D|CGI-95|MOB1|MOB3|MOBKL3|PHOCN|PREI3 | |
Cytomap | 2q31.2 | 2q33.1 | |
Type of gene | protein-coding | protein-coding | |
Description | alkyldihydroxyacetonephosphate synthase, peroxisomalaging-associated gene 5 proteinaging-associated protein 5alkyl-DHAP synthase | MOB-like protein phoceinMOB1, Mps One Binder kinase activator-like 3Mps One Binder kinase activator-like 3class II mMOB1mob1 homolog 3phocein, Mob-like proteinpreimplantation protein 3 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | O00116 | Q9Y3A3 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000264167, ENST00000409888, | ENST00000409360, ENST00000497443, ENST00000323303, ENST00000409916, ENST00000448447, ENST00000233892, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 8 X 8 X 7=448 | 2 X 2 X 2=8 |
# samples | 10 | 2 | |
** MAII score | log2(10/448*10)=-2.16349873228288 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(2/8*10)=1.32192809488736 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: AGPS [Title/Abstract] AND MOB4 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | AGPS(178378636)-MOB4(198404835), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | AGPS-MOB4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. AGPS-MOB4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. AGPS-MOB4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. AGPS-MOB4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | AGPS | GO:0008610 | lipid biosynthetic process | 9553082 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | HNSC | TCGA-DQ-7594-01A | AGPS | chr2 | 178378636 | + | MOB4 | chr2 | 198404835 | + |
ChimerDB4 | HNSC | TCGA-DQ-7594 | AGPS | chr2 | 178378636 | + | MOB4 | chr2 | 198404835 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000264167 | AGPS | chr2 | 178378636 | + | ENST00000233892 | MOB4 | chr2 | 198404835 | + | 5350 | 1843 | 68 | 2296 | 742 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000264167 | ENST00000233892 | AGPS | chr2 | 178378636 | + | MOB4 | chr2 | 198404835 | + | 0.000129085 | 0.9998709 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >2981_2981_1_AGPS-MOB4_AGPS_chr2_178378636_ENST00000264167_MOB4_chr2_198404835_ENST00000233892_length(amino acids)=742AA_BP=591 MVAPGAALSDLSPAPSGSGRQHKAVAMAEAAAAAGGTGLGAGASYGSAADRDRDPDPDRAGRRLRVLSGHLLGRPREALSTNECKARRAA SAATAAPTATPAAQESGTIPKKRQEVMKWNGWGYNDSKFIFNKKGQIELTGKRYPLSGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSD TPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLHEIFLLREGMFERIPDIVLWPTCHDDVVKIVNLACKYNLCIIPIGGGTSVSYG LMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQELERQLKESGYCTGHEPDSLEFSTVGGWVSTRASGMKKNIYGNIEDLVV HIKMVTPRGIIEKSCQGPRMSTGPDIHHFIMGSEGTLGVITEATIKIRPVPEYQKYGSVAFPNFEQGVACLREIAKQRCAPASIRLMDNK QFQFGHALKPQVSSIFTSFLDGLKKFYITKFKGFDPNQLSVATLLFEGDREKVLQHEKQVYDIAAKFGGLAAGEDNGQRGYLLTYVIAYI RDLALEYYVLGESFETSAPWDRVVDLCRNVKERITRECKEKGVQFAPFSTCRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAH KTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSK -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:178378636/chr2:198404835) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
AGPS | MOB4 |
FUNCTION: Catalyzes the exchange of the acyl chain in acyl-dihydroxyacetonephosphate (acyl-DHAP) for a long chain fatty alcohol, yielding the first ether linked intermediate, i.e. alkyl-dihydroxyacetonephosphate (alkyl-DHAP), in the pathway of ether lipid biosynthesis. {ECO:0000269|PubMed:8399344, ECO:0000269|PubMed:9553082}. | FUNCTION: May play a role in membrane trafficking, specifically in membrane budding reactions. {ECO:0000250}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | AGPS | chr2:178378636 | chr2:198404835 | ENST00000264167 | + | 17 | 20 | 2_8 | 565.6666666666666 | 659.0 | Compositional bias | Note=Poly-Ala |
Hgene | AGPS | chr2:178378636 | chr2:198404835 | ENST00000264167 | + | 17 | 20 | 202_384 | 565.6666666666666 | 659.0 | Domain | FAD-binding PCMH-type |
Hgene | AGPS | chr2:178378636 | chr2:198404835 | ENST00000264167 | + | 17 | 20 | 234_240 | 565.6666666666666 | 659.0 | Nucleotide binding | FAD |
Hgene | AGPS | chr2:178378636 | chr2:198404835 | ENST00000264167 | + | 17 | 20 | 303_309 | 565.6666666666666 | 659.0 | Nucleotide binding | FAD |
Hgene | AGPS | chr2:178378636 | chr2:198404835 | ENST00000264167 | + | 17 | 20 | 316_319 | 565.6666666666666 | 659.0 | Nucleotide binding | FAD |
Hgene | AGPS | chr2:178378636 | chr2:198404835 | ENST00000264167 | + | 17 | 20 | 368_374 | 565.6666666666666 | 659.0 | Nucleotide binding | FAD |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | AGPS | chr2:178378636 | chr2:198404835 | ENST00000264167 | + | 17 | 20 | 615_617 | 565.6666666666666 | 659.0 | Region | Important for enzyme activity |
Hgene | AGPS | chr2:178378636 | chr2:198404835 | ENST00000264167 | + | 17 | 20 | 654_658 | 565.6666666666666 | 659.0 | Region | Important for enzyme activity |
Top |
Fusion Protein Structures |
![]() * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
Top |
pLDDT score distribution |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
AGPS_pLDDT.png![]() |
MOB4_pLDDT.png![]() |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Top |
Ramachandran Plot of Fusion Protein Structure |
![]() |
Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
AGPS | |
MOB4 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to AGPS-MOB4 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to AGPS-MOB4 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |