| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:GAS6-GPC5 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: GAS6-GPC5 | FusionPDB ID: 32532 | FusionGDB2.0 ID: 32532 | Hgene | Tgene | Gene symbol | GAS6 | GPC5 | Gene ID | 2621 | 2262 |
| Gene name | growth arrest specific 6 | glypican 5 | |
| Synonyms | AXLLG|AXSF | - | |
| Cytomap | 13q34 | 13q31.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | growth arrest-specific protein 6AXL receptor tyrosine kinase ligandAXL stimulatory factor | glypican-5bA93M14.1glypican proteoglycan 5 | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q14393 | P78333 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000327773, ENST00000357389, ENST00000476291, ENST00000355761, ENST00000418959, ENST00000450766, | ENST00000483422, ENST00000377067, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 21 X 12 X 12=3024 | 18 X 14 X 8=2016 |
| # samples | 29 | 20 | |
| ** MAII score | log2(29/3024*10)=-3.38233333420614 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(20/2016*10)=-3.33342373372519 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: GAS6 [Title/Abstract] AND GPC5 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | GAS6(114566548)-GPC5(93518535), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | GAS6-GPC5 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. GAS6-GPC5 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | GAS6 | GO:0001934 | positive regulation of protein phosphorylation | 7854420|16723520|20103767 |
| Hgene | GAS6 | GO:0006468 | protein phosphorylation | 16359517 |
| Hgene | GAS6 | GO:0006909 | phagocytosis | 21501828 |
| Hgene | GAS6 | GO:0007165 | signal transduction | 7854420|18680538 |
| Hgene | GAS6 | GO:0010628 | positive regulation of gene expression | 19657094 |
| Hgene | GAS6 | GO:0010804 | negative regulation of tumor necrosis factor-mediated signaling pathway | 19657094 |
| Hgene | GAS6 | GO:0018105 | peptidyl-serine phosphorylation | 18680538|20103767 |
| Hgene | GAS6 | GO:0019064 | fusion of virus membrane with host plasma membrane | 21501828 |
| Hgene | GAS6 | GO:0019079 | viral genome replication | 21501828 |
| Hgene | GAS6 | GO:0032689 | negative regulation of interferon-gamma production | 18840707 |
| Hgene | GAS6 | GO:0032715 | negative regulation of interleukin-6 production | 19657094 |
| Hgene | GAS6 | GO:0032720 | negative regulation of tumor necrosis factor production | 19657094|20103767 |
| Hgene | GAS6 | GO:0032825 | positive regulation of natural killer cell differentiation | 18840707 |
| Hgene | GAS6 | GO:0033138 | positive regulation of peptidyl-serine phosphorylation | 16723520 |
| Hgene | GAS6 | GO:0035457 | cellular response to interferon-alpha | 19657094 |
| Hgene | GAS6 | GO:0035690 | cellular response to drug | 16359517 |
| Hgene | GAS6 | GO:0035754 | B cell chemotaxis | 19922767 |
| Hgene | GAS6 | GO:0043066 | negative regulation of apoptotic process | 19922767 |
| Hgene | GAS6 | GO:0043154 | negative regulation of cysteine-type endopeptidase activity involved in apoptotic process | 16723520 |
| Hgene | GAS6 | GO:0043277 | apoptotic cell clearance | 21501828 |
| Hgene | GAS6 | GO:0043433 | negative regulation of DNA-binding transcription factor activity | 18680538 |
| Hgene | GAS6 | GO:0043491 | protein kinase B signaling | 16723520|20103767 |
| Hgene | GAS6 | GO:0045860 | positive regulation of protein kinase activity | 7854420 |
| Hgene | GAS6 | GO:0045892 | negative regulation of transcription, DNA-templated | 18680538 |
| Hgene | GAS6 | GO:0046718 | viral entry into host cell | 21501828 |
| Hgene | GAS6 | GO:0046813 | receptor-mediated virion attachment to host cell | 21501828 |
| Hgene | GAS6 | GO:0046827 | positive regulation of protein export from nucleus | 18680538 |
| Hgene | GAS6 | GO:0048146 | positive regulation of fibroblast proliferation | 7854420|15184064 |
| Hgene | GAS6 | GO:0050711 | negative regulation of interleukin-1 secretion | 20103767 |
| Hgene | GAS6 | GO:0050766 | positive regulation of phagocytosis | 18395422 |
| Hgene | GAS6 | GO:0051897 | positive regulation of protein kinase B signaling | 16359517|16723520|18680538 |
| Hgene | GAS6 | GO:0061098 | positive regulation of protein tyrosine kinase activity | 20103767 |
| Hgene | GAS6 | GO:0070168 | negative regulation of biomineral tissue development | 20048160 |
| Hgene | GAS6 | GO:0070374 | positive regulation of ERK1 and ERK2 cascade | 15184064 |
| Hgene | GAS6 | GO:0070588 | calcium ion transmembrane transport | 18395422 |
| Hgene | GAS6 | GO:0071307 | cellular response to vitamin K | 16359517 |
| Hgene | GAS6 | GO:0072659 | protein localization to plasma membrane | 16359517 |
| Hgene | GAS6 | GO:0097241 | hematopoietic stem cell migration to bone marrow | 19922767 |
| Hgene | GAS6 | GO:1900142 | negative regulation of oligodendrocyte apoptotic process | 16723520 |
| Hgene | GAS6 | GO:1900165 | negative regulation of interleukin-6 secretion | 20103767 |
| Hgene | GAS6 | GO:2000270 | negative regulation of fibroblast apoptotic process | 16359517 |
| Hgene | GAS6 | GO:2000352 | negative regulation of endothelial cell apoptotic process | 16359517|18680538|18760998 |
| Hgene | GAS6 | GO:2000510 | positive regulation of dendritic cell chemotaxis | 19657094 |
| Hgene | GAS6 | GO:2000669 | negative regulation of dendritic cell apoptotic process | 19657094 |
| Fusion gene breakpoints across GAS6 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across GPC5 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | LUAD | TCGA-O1-A52J-01A | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000357389 | GAS6 | chr13 | 114566548 | - | ENST00000377067 | GPC5 | chr13 | 93518535 | + | 1364 | 408 | 432 | 1 | 144 |
| ENST00000327773 | GAS6 | chr13 | 114566548 | - | ENST00000377067 | GPC5 | chr13 | 93518535 | + | 1358 | 402 | 426 | 1 | 142 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000357389 | ENST00000377067 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + | 0.06725784 | 0.9327421 |
| ENST00000327773 | ENST00000377067 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + | 0.046932377 | 0.95306766 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >32532_32532_1_GAS6-GPC5_GAS6_chr13_114566548_ENST00000327773_GPC5_chr13_93518535_ENST00000377067_length(amino acids)=142AA_BP= MKFISSGIPSRGRSRTPPAPPRGCTAPPRTPSPGGPAWPPRRPERRGAAWAAGTAWPRAPATARQARTPRPAAAAAAAARGAGRRARARA -------------------------------------------------------------- >32532_32532_2_GAS6-GPC5_GAS6_chr13_114566548_ENST00000357389_GPC5_chr13_93518535_ENST00000377067_length(amino acids)=144AA_BP= MKFISSGIPSRGRSRTPPAPPRGCTAPPRTPSPGGPAWPPRRPERRGAAWAAGTAWPRAPATARQARTPRPAAAAAAAARGAGRRARARA -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr13:114566548/chr13:93518535) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| GAS6 | GPC5 |
| FUNCTION: Ligand for tyrosine-protein kinase receptors AXL, TYRO3 and MER whose signaling is implicated in cell growth and survival, cell adhesion and cell migration. GAS6/AXL signaling plays a role in various processes such as endothelial cell survival during acidification by preventing apoptosis, optimal cytokine signaling during human natural killer cell development, hepatic regeneration, gonadotropin-releasing hormone neuron survival and migration, platelet activation, or regulation of thrombotic responses. {ECO:0000269|PubMed:12364394, ECO:0000269|PubMed:18840707}.; FUNCTION: (Microbial infection) Can bridge virus envelope phosphatidylserine to the TAM receptor tyrosine kinase Axl to mediate viral entry by apoptotic mimicry (PubMed:21501828). Plays a role in Dengue cell entry by apoptotic mimicry (PubMed:23084921). Plays a role in Vaccinia virus cell entry by apoptotic mimicry (PubMed:21501828). Plays a role in ebolavirus and marburgvirus cell entry by apoptotic mimicry (PubMed:17005688). {ECO:0000269|PubMed:17005688, ECO:0000269|PubMed:21501828, ECO:0000269|PubMed:23084921}. | FUNCTION: Cell surface proteoglycan that bears heparan sulfate. {ECO:0000250}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 116_154 | 85.0 | 679.0 | Domain | EGF-like 1%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 156_196 | 85.0 | 679.0 | Domain | EGF-like 2%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 197_237 | 85.0 | 679.0 | Domain | EGF-like 3%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 238_278 | 85.0 | 679.0 | Domain | EGF-like 4%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 298_470 | 85.0 | 679.0 | Domain | Laminin G-like 1 |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 477_670 | 85.0 | 679.0 | Domain | Laminin G-like 2 |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 53_94 | 85.0 | 679.0 | Domain | Gla |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 116_154 | 0.0 | 625.0 | Domain | EGF-like 1%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 156_196 | 0.0 | 625.0 | Domain | EGF-like 2%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 197_237 | 0.0 | 625.0 | Domain | EGF-like 3%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 238_278 | 0.0 | 625.0 | Domain | EGF-like 4%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 298_470 | 0.0 | 625.0 | Domain | Laminin G-like 1 |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 477_670 | 0.0 | 625.0 | Domain | Laminin G-like 2 |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 53_94 | 0.0 | 625.0 | Domain | Gla |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 116_154 | 0 | 380.0 | Domain | EGF-like 1%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 156_196 | 0 | 380.0 | Domain | EGF-like 2%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 197_237 | 0 | 380.0 | Domain | EGF-like 3%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 238_278 | 0 | 380.0 | Domain | EGF-like 4%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 298_470 | 0 | 380.0 | Domain | Laminin G-like 1 |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 477_670 | 0 | 380.0 | Domain | Laminin G-like 2 |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 53_94 | 0 | 380.0 | Domain | Gla |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 116_154 | 0 | 406.0 | Domain | EGF-like 1%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 156_196 | 0 | 406.0 | Domain | EGF-like 2%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 197_237 | 0 | 406.0 | Domain | EGF-like 3%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 238_278 | 0 | 406.0 | Domain | EGF-like 4%3B calcium-binding |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 298_470 | 0 | 406.0 | Domain | Laminin G-like 1 |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 477_670 | 0 | 406.0 | Domain | Laminin G-like 2 |
| Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 53_94 | 0 | 406.0 | Domain | Gla |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| GAS6 | |
| GPC5 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to GAS6-GPC5 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to GAS6-GPC5 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies