UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:GLS-DIS3L2 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: GLS-DIS3L2 | FusionPDB ID: 33354 | FusionGDB2.0 ID: 33354 | Hgene | Tgene | Gene symbol | GLS | DIS3L2 | Gene ID | 27165 | 129563 |
Gene name | glutaminase 2 | DIS3 like 3'-5' exoribonuclease 2 | |
Synonyms | GA|GLS|LGA|hLGA | FAM6A|PRLMNS|hDIS3L2 | |
Cytomap | 12q13.3 | 2q37.1 | |
Type of gene | protein-coding | protein-coding | |
Description | glutaminase liver isoform, mitochondrialL-glutamine amidohydrolasebreast cell glutaminaseglutaminase 2 (liver, mitochondrial)glutaminase Iphosphate-activated glutaminasephosphate-dependent glutaminase | DIS3-like exonuclease 2DIS3 mitotic control homolog-like 2family with sequence similarity 6, member A | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q9UI32 | Q8IYB7 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000320717, ENST00000338435, ENST00000409215, ENST00000409428, ENST00000409626, ENST00000471443, | ENST00000409307, ENST00000409401, ENST00000470087, ENST00000360410, ENST00000273009, ENST00000325385, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 8 X 8 X 6=384 | 8 X 8 X 6=384 |
# samples | 10 | 9 | |
** MAII score | log2(10/384*10)=-1.94110631094643 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/384*10)=-2.09310940439148 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: GLS [Title/Abstract] AND DIS3L2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | GLS(191746196)-DIS3L2(233028169), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | GLS-DIS3L2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. GLS-DIS3L2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. GLS-DIS3L2 seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. GLS-DIS3L2 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | DIS3L2 | GO:0010587 | miRNA catabolic process | 24141620 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | Non-Cancer | TCGA-HU-A4GC-11A | GLS | chr2 | 191746196 | + | DIS3L2 | chr2 | 233028169 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000320717 | GLS | chr2 | 191746196 | + | ENST00000273009 | DIS3L2 | chr2 | 233028169 | + | 2281 | 644 | 258 | 1505 | 415 |
ENST00000320717 | GLS | chr2 | 191746196 | + | ENST00000325385 | DIS3L2 | chr2 | 233028169 | + | 2919 | 644 | 258 | 2351 | 697 |
ENST00000338435 | GLS | chr2 | 191746196 | + | ENST00000273009 | DIS3L2 | chr2 | 233028169 | + | 2274 | 637 | 251 | 1498 | 415 |
ENST00000338435 | GLS | chr2 | 191746196 | + | ENST00000325385 | DIS3L2 | chr2 | 233028169 | + | 2912 | 637 | 251 | 2344 | 697 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000320717 | ENST00000273009 | GLS | chr2 | 191746196 | + | DIS3L2 | chr2 | 233028169 | + | 0.038966823 | 0.9610332 |
ENST00000320717 | ENST00000325385 | GLS | chr2 | 191746196 | + | DIS3L2 | chr2 | 233028169 | + | 0.020901775 | 0.9790982 |
ENST00000338435 | ENST00000273009 | GLS | chr2 | 191746196 | + | DIS3L2 | chr2 | 233028169 | + | 0.038758308 | 0.96124166 |
ENST00000338435 | ENST00000325385 | GLS | chr2 | 191746196 | + | DIS3L2 | chr2 | 233028169 | + | 0.02102808 | 0.97897196 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >33354_33354_1_GLS-DIS3L2_GLS_chr2_191746196_ENST00000320717_DIS3L2_chr2_233028169_ENST00000273009_length(amino acids)=415AA_BP=129 MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGSTHP QPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGEKQLAKSLGQAGEIEPETEGILTEYGVDFSDFSSEVLECLPQGLPWTIPPEEF SKRRDLRKDCIFTIDPSTARDLDDALSCKPLADGNFKVGVHIADVSYFVPEGSDLDKVAAERATSVYLVQKVVPMLPRLLCEELCSLNPM SDKLTFSVIWTLTPEGKILDEWFGRTIIRSCTKLSYEHAQSMIESPTEKIPAKELPPISPEHSSEEVHQQNADKDGAAHLQASHSPSAED -------------------------------------------------------------- >33354_33354_2_GLS-DIS3L2_GLS_chr2_191746196_ENST00000320717_DIS3L2_chr2_233028169_ENST00000325385_length(amino acids)=697AA_BP=129 MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGSTHP QPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGEKQLAKSLGQAGEIEPETEGILTEYGVDFSDFSSEVLECLPQGLPWTIPPEEF SKRRDLRKDCIFTIDPSTARDLDDALSCKPLADGNFKVGVHIADVSYFVPEGSDLDKVAAERATSVYLVQKVVPMLPRLLCEELCSLNPM SDKLTFSVIWTLTPEGKILDEWFGRTIIRSCTKLSYEHAQSMIESPTEKIPAKELPPISPEHSSEEVHQAVLNLHGIAKQLRQQRFVDGA LRLDQLKLAFTLDHETGLPQGCHIYEYRESNKLVEEFMLLANMAVAHKIHRAFPEQALLRRHPPPQTRMLSDLVEFCDQMGLPVDFSSAG ALNKSLTQTFGDDKYSLARKEVLTNMCSRPMQMALYFCSGLLQDPAQFRHYALNVPLYTHFTSPIRRFADVLVHRLLAAALGYRERLDMA PDTLQKQADHCNDRRMASKRVQELSTSLFFAVLVKESGPLESEAMVMGILKQAFDVLVLRYGVQKRIYCNALALRSHHFQKVGKKPELTL -------------------------------------------------------------- >33354_33354_3_GLS-DIS3L2_GLS_chr2_191746196_ENST00000338435_DIS3L2_chr2_233028169_ENST00000273009_length(amino acids)=415AA_BP=129 MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGSTHP QPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGEKQLAKSLGQAGEIEPETEGILTEYGVDFSDFSSEVLECLPQGLPWTIPPEEF SKRRDLRKDCIFTIDPSTARDLDDALSCKPLADGNFKVGVHIADVSYFVPEGSDLDKVAAERATSVYLVQKVVPMLPRLLCEELCSLNPM SDKLTFSVIWTLTPEGKILDEWFGRTIIRSCTKLSYEHAQSMIESPTEKIPAKELPPISPEHSSEEVHQQNADKDGAAHLQASHSPSAED -------------------------------------------------------------- >33354_33354_4_GLS-DIS3L2_GLS_chr2_191746196_ENST00000338435_DIS3L2_chr2_233028169_ENST00000325385_length(amino acids)=697AA_BP=129 MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGSTHP QPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGEKQLAKSLGQAGEIEPETEGILTEYGVDFSDFSSEVLECLPQGLPWTIPPEEF SKRRDLRKDCIFTIDPSTARDLDDALSCKPLADGNFKVGVHIADVSYFVPEGSDLDKVAAERATSVYLVQKVVPMLPRLLCEELCSLNPM SDKLTFSVIWTLTPEGKILDEWFGRTIIRSCTKLSYEHAQSMIESPTEKIPAKELPPISPEHSSEEVHQAVLNLHGIAKQLRQQRFVDGA LRLDQLKLAFTLDHETGLPQGCHIYEYRESNKLVEEFMLLANMAVAHKIHRAFPEQALLRRHPPPQTRMLSDLVEFCDQMGLPVDFSSAG ALNKSLTQTFGDDKYSLARKEVLTNMCSRPMQMALYFCSGLLQDPAQFRHYALNVPLYTHFTSPIRRFADVLVHRLLAAALGYRERLDMA PDTLQKQADHCNDRRMASKRVQELSTSLFFAVLVKESGPLESEAMVMGILKQAFDVLVLRYGVQKRIYCNALALRSHHFQKVGKKPELTL -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:191746196/chr2:233028169) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
GLS | DIS3L2 |
FUNCTION: Plays an important role in the regulation of glutamine catabolism. Promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. Increases cellular anti-oxidant function via NADH and glutathione production. May play a role in preventing tumor proliferation. {ECO:0000269|PubMed:20378837}. | FUNCTION: 3'-5'-exoribonuclease that specifically recognizes RNAs polyuridylated at their 3' end and mediates their degradation. Component of an exosome-independent RNA degradation pathway that mediates degradation of both mRNAs and miRNAs that have been polyuridylated by a terminal uridylyltransferase, such as ZCCHC11/TUT4. Mediates degradation of cytoplasmic mRNAs that have been deadenylated and subsequently uridylated at their 3'. Mediates degradation of uridylated pre-let-7 miRNAs, contributing to the maintenance of embryonic stem (ES) cells. Essential for correct mitosis, and negatively regulates cell proliferation. {ECO:0000255|HAMAP-Rule:MF_03045, ECO:0000269|PubMed:23756462, ECO:0000269|PubMed:24141620}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | GLS | chr2:191746196 | chr2:233028169 | ENST00000320717 | + | 1 | 18 | 315_322 | 128.66666666666666 | 670.0 | Region | Highly mobile activation loop |
Hgene | GLS | chr2:191746196 | chr2:233028169 | ENST00000338435 | + | 1 | 15 | 315_322 | 128.66666666666666 | 599.0 | Region | Highly mobile activation loop |
Hgene | GLS | chr2:191746196 | chr2:233028169 | ENST00000320717 | + | 1 | 18 | 585_614 | 128.66666666666666 | 670.0 | Repeat | Note=ANK 1 |
Hgene | GLS | chr2:191746196 | chr2:233028169 | ENST00000320717 | + | 1 | 18 | 619_648 | 128.66666666666666 | 670.0 | Repeat | Note=ANK 2 |
Hgene | GLS | chr2:191746196 | chr2:233028169 | ENST00000338435 | + | 1 | 15 | 585_614 | 128.66666666666666 | 599.0 | Repeat | Note=ANK 1 |
Hgene | GLS | chr2:191746196 | chr2:233028169 | ENST00000338435 | + | 1 | 15 | 619_648 | 128.66666666666666 | 599.0 | Repeat | Note=ANK 2 |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
GLS | |
DIS3L2 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to GLS-DIS3L2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to GLS-DIS3L2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |