UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:IFT20-GLS |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: IFT20-GLS | FusionPDB ID: 38416 | FusionGDB2.0 ID: 38416 | Hgene | Tgene | Gene symbol | IFT20 | GLS | Gene ID | 90410 | 27165 |
Gene name | intraflagellar transport 20 | glutaminase 2 | |
Synonyms | - | GA|GLS|LGA|hLGA | |
Cytomap | 17q11.2 | 12q13.3 | |
Type of gene | protein-coding | protein-coding | |
Description | intraflagellar transport protein 20 homologintraflagellar transport 20 homologintraflagellar transport protein IFT20 | glutaminase liver isoform, mitochondrialL-glutamine amidohydrolasebreast cell glutaminaseglutaminase 2 (liver, mitochondrial)glutaminase Iphosphate-activated glutaminasephosphate-dependent glutaminase | |
Modification date | 20200327 | 20200313 | |
UniProtAcc | Q8IY31 | Q9UI32 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000357896, ENST00000395418, ENST00000578122, ENST00000578985, ENST00000579419, ENST00000585089, ENST00000585313, | ENST00000338435, ENST00000409215, ENST00000409428, ENST00000409626, ENST00000471443, ENST00000320717, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 3 X 3 X 3=27 | 12 X 9 X 5=540 |
# samples | 3 | 12 | |
** MAII score | log2(3/27*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(12/540*10)=-2.16992500144231 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: IFT20 [Title/Abstract] AND GLS [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | IFT20(26658882)-GLS(191827556), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | IFT20-GLS seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. IFT20-GLS seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. IFT20-GLS seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. IFT20-GLS seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. IFT20-GLS seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. IFT20-GLS seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. IFT20-GLS seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChiTaRS5.0 | N/A | DC316034 | IFT20 | chr17 | 26658882 | - | GLS | chr2 | 191827556 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000585089 | IFT20 | chr17 | 26658882 | - | ENST00000320717 | GLS | chr2 | 191827556 | + | 3199 | 476 | 256 | 672 | 138 |
ENST00000578122 | IFT20 | chr17 | 26658882 | - | ENST00000320717 | GLS | chr2 | 191827556 | + | 3185 | 462 | 242 | 658 | 138 |
ENST00000578985 | IFT20 | chr17 | 26658882 | - | ENST00000320717 | GLS | chr2 | 191827556 | + | 3190 | 467 | 247 | 663 | 138 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000585089 | ENST00000320717 | IFT20 | chr17 | 26658882 | - | GLS | chr2 | 191827556 | + | 0.017680187 | 0.9823198 |
ENST00000578122 | ENST00000320717 | IFT20 | chr17 | 26658882 | - | GLS | chr2 | 191827556 | + | 0.017822243 | 0.98217773 |
ENST00000578985 | ENST00000320717 | IFT20 | chr17 | 26658882 | - | GLS | chr2 | 191827556 | + | 0.017833116 | 0.9821669 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >38416_38416_1_IFT20-GLS_IFT20_chr17_26658882_ENST00000578122_GLS_chr2_191827556_ENST00000320717_length(amino acids)=138AA_BP=74 MTLAPMTHLLLTATVTPSEQNSSREPGWETAMAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDSGITLPWMKHCTLDTMM -------------------------------------------------------------- >38416_38416_2_IFT20-GLS_IFT20_chr17_26658882_ENST00000578985_GLS_chr2_191827556_ENST00000320717_length(amino acids)=138AA_BP=74 MTLAPMTHLLLTATVTPSEQNSSREPGWETAMAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDSGITLPWMKHCTLDTMM -------------------------------------------------------------- >38416_38416_3_IFT20-GLS_IFT20_chr17_26658882_ENST00000585089_GLS_chr2_191827556_ENST00000320717_length(amino acids)=138AA_BP=74 MTLAPMTHLLLTATVTPSEQNSSREPGWETAMAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDSGITLPWMKHCTLDTMM -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr17:26658882/chr2:191827556) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
IFT20 | GLS |
FUNCTION: Part of intraflagellar transport (IFT) particles involved in ciliary process assembly. May play a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium (PubMed:16775004). Regulates the platelet-derived growth factor receptor-alpha (PDGFRA) signaling pathway. Required for protein stability of E3 ubiquitin ligases CBL and CBLB that mediate ubiquitination and internalization of PDGFRA for proper feedback inhibition of PDGFRA signaling (PubMed:29237719). Essential for male fertility. Plays an important role in spermatogenesis, particularly spermiogenesis, when germ cells form flagella. May play a role in the transport of flagellar proteins ODF2 and SPAG16 to build sperm flagella and in the removal of redundant sperm cytoplasm (By similarity). Also involved in autophagy since it is required for trafficking of ATG16L and the expansion of the autophagic compartment (By similarity). {ECO:0000250|UniProtKB:Q61025, ECO:0000269|PubMed:16775004, ECO:0000269|PubMed:29237719}. | FUNCTION: Plays an important role in the regulation of glutamine catabolism. Promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. Increases cellular anti-oxidant function via NADH and glutathione production. May play a role in preventing tumor proliferation. {ECO:0000269|PubMed:20378837}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | GLS | chr17:26658882 | chr2:191827556 | ENST00000338435 | 0 | 15 | 315_322 | 0 | 599.0 | Region | Highly mobile activation loop | |
Tgene | GLS | chr17:26658882 | chr2:191827556 | ENST00000320717 | 16 | 18 | 619_648 | 617.6666666666666 | 670.0 | Repeat | Note=ANK 2 | |
Tgene | GLS | chr17:26658882 | chr2:191827556 | ENST00000338435 | 0 | 15 | 585_614 | 0 | 599.0 | Repeat | Note=ANK 1 | |
Tgene | GLS | chr17:26658882 | chr2:191827556 | ENST00000338435 | 0 | 15 | 619_648 | 0 | 599.0 | Repeat | Note=ANK 2 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | IFT20 | chr17:26658882 | chr2:191827556 | ENST00000357896 | - | 2 | 6 | 74_114 | 42.333333333333336 | 149.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | IFT20 | chr17:26658882 | chr2:191827556 | ENST00000395418 | - | 2 | 5 | 74_114 | 42.333333333333336 | 133.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | IFT20 | chr17:26658882 | chr2:191827556 | ENST00000579419 | - | 3 | 6 | 74_114 | 42.333333333333336 | 115.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | IFT20 | chr17:26658882 | chr2:191827556 | ENST00000585089 | - | 3 | 6 | 74_114 | 68.33333333333333 | 159.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | IFT20 | chr17:26658882 | chr2:191827556 | ENST00000585313 | - | 3 | 6 | 74_114 | 42.333333333333336 | 133.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | IFT20 | chr17:26658882 | chr2:191827556 | ENST00000357896 | - | 2 | 6 | 70_132 | 42.333333333333336 | 149.0 | Region | IFT57-binding |
Hgene | IFT20 | chr17:26658882 | chr2:191827556 | ENST00000395418 | - | 2 | 5 | 70_132 | 42.333333333333336 | 133.0 | Region | IFT57-binding |
Hgene | IFT20 | chr17:26658882 | chr2:191827556 | ENST00000579419 | - | 3 | 6 | 70_132 | 42.333333333333336 | 115.0 | Region | IFT57-binding |
Hgene | IFT20 | chr17:26658882 | chr2:191827556 | ENST00000585089 | - | 3 | 6 | 70_132 | 68.33333333333333 | 159.0 | Region | IFT57-binding |
Hgene | IFT20 | chr17:26658882 | chr2:191827556 | ENST00000585313 | - | 3 | 6 | 70_132 | 42.333333333333336 | 133.0 | Region | IFT57-binding |
Tgene | GLS | chr17:26658882 | chr2:191827556 | ENST00000320717 | 16 | 18 | 315_322 | 617.6666666666666 | 670.0 | Region | Highly mobile activation loop | |
Tgene | GLS | chr17:26658882 | chr2:191827556 | ENST00000320717 | 16 | 18 | 585_614 | 617.6666666666666 | 670.0 | Repeat | Note=ANK 1 |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
IFT20 | |
GLS |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to IFT20-GLS |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to IFT20-GLS |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |