UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:ING5-UTRN |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: ING5-UTRN | FusionPDB ID: 39749 | FusionGDB2.0 ID: 39749 | Hgene | Tgene | Gene symbol | ING5 | UTRN | Gene ID | 84289 | 7402 |
Gene name | inhibitor of growth family member 5 | utrophin | |
Synonyms | p28ING5 | DMDL|DRP|DRP1 | |
Cytomap | 2q37.3 | 6q24.2 | |
Type of gene | protein-coding | protein-coding | |
Description | inhibitor of growth protein 5 | utrophinDRP-1dystrophin-related protein 1 | |
Modification date | 20200329 | 20200313 | |
UniProtAcc | Q8WYH8 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000482774, ENST00000313552, ENST00000406941, | ENST00000367526, ENST00000367545, ENST00000480333, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 2 X 2 X 2=8 | 41 X 16 X 12=7872 |
# samples | 2 | 42 | |
** MAII score | log2(2/8*10)=1.32192809488736 | log2(42/7872*10)=-4.22826898767312 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: ING5 [Title/Abstract] AND UTRN [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ING5(242651486)-UTRN(145148484), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | ING5-UTRN seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ING5-UTRN seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ING5 | GO:0006260 | DNA replication | 16387653 |
Hgene | ING5 | GO:0006473 | protein acetylation | 12750254 |
Hgene | ING5 | GO:0008285 | negative regulation of cell proliferation | 12750254 |
Hgene | ING5 | GO:0043966 | histone H3 acetylation | 16387653 |
Hgene | ING5 | GO:0045893 | positive regulation of transcription, DNA-templated | 16387653 |
Hgene | ING5 | GO:0045926 | negative regulation of growth | 12750254 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-GM-A2DN-01A | ING5 | chr2 | 242651486 | + | UTRN | chr6 | 145148484 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000313552 | ING5 | chr2 | 242651486 | + | ENST00000367545 | UTRN | chr6 | 145148484 | + | 3353 | 508 | 26 | 1315 | 429 |
ENST00000313552 | ING5 | chr2 | 242651486 | + | ENST00000367526 | UTRN | chr6 | 145148484 | + | 1322 | 508 | 26 | 1315 | 429 |
ENST00000406941 | ING5 | chr2 | 242651486 | + | ENST00000367545 | UTRN | chr6 | 145148484 | + | 3347 | 502 | 20 | 1309 | 429 |
ENST00000406941 | ING5 | chr2 | 242651486 | + | ENST00000367526 | UTRN | chr6 | 145148484 | + | 1316 | 502 | 20 | 1309 | 429 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000313552 | ENST00000367545 | ING5 | chr2 | 242651486 | + | UTRN | chr6 | 145148484 | + | 0.000469572 | 0.99953043 |
ENST00000313552 | ENST00000367526 | ING5 | chr2 | 242651486 | + | UTRN | chr6 | 145148484 | + | 0.004552317 | 0.9954477 |
ENST00000406941 | ENST00000367545 | ING5 | chr2 | 242651486 | + | UTRN | chr6 | 145148484 | + | 0.000469012 | 0.99953103 |
ENST00000406941 | ENST00000367526 | ING5 | chr2 | 242651486 | + | UTRN | chr6 | 145148484 | + | 0.004197627 | 0.99580234 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >39749_39749_1_ING5-UTRN_ING5_chr2_242651486_ENST00000313552_UTRN_chr6_145148484_ENST00000367526_length(amino acids)=429AA_BP=161 MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQLAMQTY EMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGPITLISMWPEHYDPSQSPQ LFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGESPVSQPQSPAQILKSVEREERGELERIIADLEEEQ RNLQVEYEQLKDQHLRRGLPVGSPPESIISPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESDSRING -------------------------------------------------------------- >39749_39749_2_ING5-UTRN_ING5_chr2_242651486_ENST00000313552_UTRN_chr6_145148484_ENST00000367545_length(amino acids)=429AA_BP=161 MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQLAMQTY EMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGPITLISMWPEHYDPSQSPQ LFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGESPVSQPQSPAQILKSVEREERGELERIIADLEEEQ RNLQVEYEQLKDQHLRRGLPVGSPPESIISPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESDSRING -------------------------------------------------------------- >39749_39749_3_ING5-UTRN_ING5_chr2_242651486_ENST00000406941_UTRN_chr6_145148484_ENST00000367526_length(amino acids)=429AA_BP=161 MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQLAMQTY EMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGPITLISMWPEHYDPSQSPQ LFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGESPVSQPQSPAQILKSVEREERGELERIIADLEEEQ RNLQVEYEQLKDQHLRRGLPVGSPPESIISPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESDSRING -------------------------------------------------------------- >39749_39749_4_ING5-UTRN_ING5_chr2_242651486_ENST00000406941_UTRN_chr6_145148484_ENST00000367545_length(amino acids)=429AA_BP=161 MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQLAMQTY EMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGPITLISMWPEHYDPSQSPQ LFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGESPVSQPQSPAQILKSVEREERGELERIIADLEEEQ RNLQVEYEQLKDQHLRRGLPVGSPPESIISPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESDSRING -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:242651486/chr6:145148484) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
ING5 | . |
FUNCTION: Component of the HBO1 complex, which specifically mediates acetylation of histone H3 at 'Lys-14' (H3K14ac) and, to a lower extent, acetylation of histone H4 (PubMed:24065767). Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity (PubMed:16387653). Through chromatin acetylation it may regulate DNA replication and may function as a transcriptional coactivator (PubMed:12750254, PubMed:16387653). Inhibits cell growth, induces a delay in S-phase progression and enhances Fas-induced apoptosis in an INCA1-dependent manner (PubMed:21750715). {ECO:0000269|PubMed:12750254, ECO:0000269|PubMed:16387653, ECO:0000269|PubMed:21750715, ECO:0000269|PubMed:24065767}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ING5 | chr2:242651486 | chr6:145148484 | ENST00000313552 | + | 5 | 8 | 186_235 | 160.66666666666666 | 241.0 | Zinc finger | PHD-type |
Hgene | ING5 | chr2:242651486 | chr6:145148484 | ENST00000406941 | + | 5 | 8 | 186_235 | 160.66666666666666 | 227.0 | Zinc finger | PHD-type |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 150_255 | 3164.6666666666665 | 3434.0 | Domain | Calponin-homology (CH) 2 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 2812_2845 | 3164.6666666666665 | 3434.0 | Domain | WW | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 31_135 | 3164.6666666666665 | 3434.0 | Domain | Calponin-homology (CH) 1 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 1_246 | 3164.6666666666665 | 3434.0 | Region | Note=Actin-binding | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 1019_1121 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 7 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 1128_1229 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 8 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 1236_1333 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 9 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 1335_1436 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 10 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 1438_1540 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 11 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 1547_1648 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 12 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 1653_1747 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 13 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 1748_1848 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 14 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 1849_1968 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 15 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 1979_2080 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 16 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 2087_2186 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 17 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 2229_2332 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 18 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 2349_2439 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 19 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 2446_2555 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 20 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 2562_2687 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 21 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 2694_2796 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 22 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 312_416 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 1 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 421_525 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 2 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 532_636 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 3 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 690_795 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 4 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 801_901 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 5 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 910_1012 | 3164.6666666666665 | 3434.0 | Repeat | Spectrin 6 | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 3064_3111 | 3164.6666666666665 | 3434.0 | Zinc finger | ZZ-type |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
ING5 | |
UTRN |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 1336_1768 | 3164.6666666666665 | 3434.0 | SYNM | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 268_905 | 3164.6666666666665 | 3434.0 | SYNM | |
Tgene | UTRN | chr2:242651486 | chr6:145148484 | ENST00000367545 | 64 | 74 | 2798_3165 | 3164.6666666666665 | 3434.0 | SYNM |
Top |
Related Drugs to ING5-UTRN |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ING5-UTRN |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |