UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:ITGAV-C19orf43 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: ITGAV-C19orf43 | FusionPDB ID: 40488 | FusionGDB2.0 ID: 40488 | Hgene | Tgene | Gene symbol | ITGAV | C19orf43 | Gene ID | 3685 | 79002 |
Gene name | integrin subunit alpha V | telomerase RNA component interacting RNase | |
Synonyms | CD51|MSK8|VNRA|VTNR | C19orf43|TERCIR|fSAP18 | |
Cytomap | 2q32.1 | 19p13.13 | |
Type of gene | protein-coding | protein-coding | |
Description | integrin alpha-Vantigen identified by monoclonal antibody L230integrin alphaVbeta3integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51)vitronectin receptor subunit alpha | telomerase RNA component interacting RNaseMy029 proteinexoribonuclease TRIRuncharacterized protein C19orf43 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | P06756 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000261023, ENST00000374907, ENST00000433736, ENST00000474571, | ENST00000588213, ENST00000592273, ENST00000242784, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 11 X 9 X 8=792 | 3 X 3 X 3=27 |
# samples | 13 | 4 | |
** MAII score | log2(13/792*10)=-2.60698880705116 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/27*10)=0.567040592723894 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: ITGAV [Title/Abstract] AND C19orf43 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ITGAV(187519435)-C19orf43(12841882), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | ITGAV-C19orf43 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ITGAV-C19orf43 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ITGAV-C19orf43 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. ITGAV-C19orf43 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. ITGAV-C19orf43 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. ITGAV-C19orf43 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ITGAV | GO:0007155 | cell adhesion | 10218736 |
Hgene | ITGAV | GO:0008284 | positive regulation of cell proliferation | 19578119 |
Hgene | ITGAV | GO:0033627 | cell adhesion mediated by integrin | 12807887|17158881 |
Hgene | ITGAV | GO:0034446 | substrate adhesion-dependent cell spreading | 24658351 |
Hgene | ITGAV | GO:0045785 | positive regulation of cell adhesion | 10708943 |
Hgene | ITGAV | GO:0050764 | regulation of phagocytosis | 10570297 |
Hgene | ITGAV | GO:0070588 | calcium ion transmembrane transport | 18395422 |
Hgene | ITGAV | GO:1901388 | regulation of transforming growth factor beta activation | 22278742 |
Hgene | ITGAV | GO:2000536 | negative regulation of entry of bacterium into host cell | 10570297 |
Tgene | C19orf43 | GO:0016075 | rRNA catabolic process | 28322335 |
Tgene | C19orf43 | GO:0090503 | RNA phosphodiester bond hydrolysis, exonucleolytic | 28322335 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | UCEC | TCGA-AP-A0LF-01A | ITGAV | chr2 | 187519435 | + | C19orf43 | chr19 | 12841882 | - |
ChimerDB4 | UCEC | TCGA-AP-A0LF | ITGAV | chr2 | 187519435 | + | C19orf43 | chr19 | 12841882 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000261023 | ITGAV | chr2 | 187519435 | + | ENST00000242784 | C19orf43 | chr19 | 12841882 | - | 2267 | 1838 | 49 | 1851 | 600 |
ENST00000374907 | ITGAV | chr2 | 187519435 | + | ENST00000242784 | C19orf43 | chr19 | 12841882 | - | 2144 | 1715 | 34 | 1728 | 564 |
ENST00000433736 | ITGAV | chr2 | 187519435 | + | ENST00000242784 | C19orf43 | chr19 | 12841882 | - | 1985 | 1556 | 130 | 1569 | 479 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000261023 | ENST00000242784 | ITGAV | chr2 | 187519435 | + | C19orf43 | chr19 | 12841882 | - | 0.002138075 | 0.9978619 |
ENST00000374907 | ENST00000242784 | ITGAV | chr2 | 187519435 | + | C19orf43 | chr19 | 12841882 | - | 0.002210048 | 0.99779 |
ENST00000433736 | ENST00000242784 | ITGAV | chr2 | 187519435 | + | C19orf43 | chr19 | 12841882 | - | 0.000801517 | 0.9991985 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >40488_40488_1_ITGAV-C19orf43_ITGAV_chr2_187519435_ENST00000261023_C19orf43_chr19_12841882_ENST00000242784_length(amino acids)=600AA_BP= MRCCPRPARSAPLVPGGRSEAQPSCLPRSCPGLAEKRAAGKFGRAQAAGRGHWAPRWGGGRWLPLPAWRPARTSAMAFPPRRRLRLGPRG LPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDAT GNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTK ADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYI YDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIA PLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILY -------------------------------------------------------------- >40488_40488_2_ITGAV-C19orf43_ITGAV_chr2_187519435_ENST00000374907_C19orf43_chr19_12841882_ENST00000242784_length(amino acids)=564AA_BP= MRCCPRPARSAPLVPGGRSEAQPSCLPRSCPGLAEKRAAGKFGRAQAAGRGHWAPRWGGGRWLPLPAWRPARTSAMAFPPRRRLRLGPRG LPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDAT GNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSRQLISDQVAEIVSKYDPNVYS IKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYA DVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRST GLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVS -------------------------------------------------------------- >40488_40488_3_ITGAV-C19orf43_ITGAV_chr2_187519435_ENST00000433736_C19orf43_chr19_12841882_ENST00000242784_length(amino acids)=479AA_BP= MLLGTLLLILYILMLCRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKIL ACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYD PNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDIN GDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIF NGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGT -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:187519435/chr19:12841882) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
ITGAV | . |
FUNCTION: The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. ITGAV:ITGB3 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1-dependent fractalkine signaling (PubMed:23125415). ITGAV:ITGB3 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling (PubMed:20682778). ITGAV:ITGB3 binds to FGF1 and this binding is essential for FGF1 signaling (PubMed:18441324). ITGAV:ITGB3 binds to FGF2 and this binding is essential for FGF2 signaling (PubMed:28302677). ITGAV:ITGB3 binds to IGF1 and this binding is essential for IGF1 signaling (PubMed:19578119). ITGAV:ITGB3 binds to IGF2 and this binding is essential for IGF2 signaling (PubMed:28873464). ITGAV:ITGB3 binds to IL1B and this binding is essential for IL1B signaling (PubMed:29030430). ITGAV:ITGB3 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed:18635536, PubMed:25398877). ITGAV:ITGB3 and ITGAV:ITGB6 act as a receptor for fibrillin-1 (FBN1) and mediate R-G-D-dependent cell adhesion to FBN1 (PubMed:12807887, PubMed:17158881). Integrin alpha-V/beta-6 or alpha-V/beta-8 (ITGAV:ITGB6 or ITGAV:ITGB8) mediates R-G-D-dependent release of transforming growth factor beta-1 (TGF-beta-1) from regulatory Latency-associated peptide (LAP), thereby playing a key role in TGF-beta-1 activation (PubMed:15184403, PubMed:22278742, PubMed:28117447). ITGAV:ITGB3 act as a receptor for CD40LG (PubMed:31331973). {ECO:0000269|PubMed:12807887, ECO:0000269|PubMed:15184403, ECO:0000269|PubMed:17158881, ECO:0000269|PubMed:18441324, ECO:0000269|PubMed:18635536, ECO:0000269|PubMed:19578119, ECO:0000269|PubMed:20682778, ECO:0000269|PubMed:22278742, ECO:0000269|PubMed:23125415, ECO:0000269|PubMed:25398877, ECO:0000269|PubMed:28117447, ECO:0000269|PubMed:28302677, ECO:0000269|PubMed:28873464, ECO:0000269|PubMed:29030430, ECO:0000269|PubMed:31331973}.; FUNCTION: (Microbial infection) Integrin ITGAV:ITGB5 acts as a receptor for Adenovirus type C. {ECO:0000269|PubMed:20615244}.; FUNCTION: (Microbial infection) Integrin ITGAV:ITGB5 and ITGAV:ITGB3 act as receptors for Coxsackievirus A9 and B1. {ECO:0000269|PubMed:15194773, ECO:0000269|PubMed:7519807, ECO:0000269|PubMed:9426447}.; FUNCTION: (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Herpes virus 8/HHV-8. {ECO:0000269|PubMed:18045938}.; FUNCTION: (Microbial infection) Integrin ITGAV:ITGB6 acts as a receptor for herpes simplex 1/HHV-1. {ECO:0000269|PubMed:24367260}.; FUNCTION: (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Human parechovirus 1. {ECO:0000269|PubMed:11160695}.; FUNCTION: (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for West nile virus. {ECO:0000269|PubMed:23658209}.; FUNCTION: (Microbial infection) In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. {ECO:0000269|PubMed:10397733}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 260_268 | 521.3333333333334 | 1049.0 | Calcium binding | Ontology_term=ECO:0000255,ECO:0000269 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 314_322 | 521.3333333333334 | 1049.0 | Calcium binding | Ontology_term=ECO:0000255,ECO:0000269 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 379_387 | 521.3333333333334 | 1049.0 | Calcium binding | Ontology_term=ECO:0000255,ECO:0000269 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 443_451 | 521.3333333333334 | 1049.0 | Calcium binding | Ontology_term=ECO:0000255,ECO:0000269 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 260_268 | 485.3333333333333 | 1013.0 | Calcium binding | Ontology_term=ECO:0000255,ECO:0000269 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 314_322 | 485.3333333333333 | 1013.0 | Calcium binding | Ontology_term=ECO:0000255,ECO:0000269 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 379_387 | 485.3333333333333 | 1013.0 | Calcium binding | Ontology_term=ECO:0000255,ECO:0000269 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 443_451 | 485.3333333333333 | 1013.0 | Calcium binding | Ontology_term=ECO:0000255,ECO:0000269 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 260_268 | 475.3333333333333 | 1003.0 | Calcium binding | Ontology_term=ECO:0000255,ECO:0000269 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 314_322 | 475.3333333333333 | 1003.0 | Calcium binding | Ontology_term=ECO:0000255,ECO:0000269 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 379_387 | 475.3333333333333 | 1003.0 | Calcium binding | Ontology_term=ECO:0000255,ECO:0000269 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 443_451 | 475.3333333333333 | 1003.0 | Calcium binding | Ontology_term=ECO:0000255,ECO:0000269 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 109_170 | 521.3333333333334 | 1049.0 | Repeat | FG-GAP 2 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 173_225 | 521.3333333333334 | 1049.0 | Repeat | FG-GAP 3 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 237_291 | 521.3333333333334 | 1049.0 | Repeat | FG-GAP 4 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 292_357 | 521.3333333333334 | 1049.0 | Repeat | FG-GAP 5 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 32_98 | 521.3333333333334 | 1049.0 | Repeat | FG-GAP 1 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 358_415 | 521.3333333333334 | 1049.0 | Repeat | FG-GAP 6 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 419_482 | 521.3333333333334 | 1049.0 | Repeat | FG-GAP 7 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 109_170 | 485.3333333333333 | 1013.0 | Repeat | FG-GAP 2 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 173_225 | 485.3333333333333 | 1013.0 | Repeat | FG-GAP 3 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 237_291 | 485.3333333333333 | 1013.0 | Repeat | FG-GAP 4 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 292_357 | 485.3333333333333 | 1013.0 | Repeat | FG-GAP 5 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 32_98 | 485.3333333333333 | 1013.0 | Repeat | FG-GAP 1 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 358_415 | 485.3333333333333 | 1013.0 | Repeat | FG-GAP 6 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 419_482 | 485.3333333333333 | 1013.0 | Repeat | FG-GAP 7 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 109_170 | 475.3333333333333 | 1003.0 | Repeat | FG-GAP 2 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 173_225 | 475.3333333333333 | 1003.0 | Repeat | FG-GAP 3 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 237_291 | 475.3333333333333 | 1003.0 | Repeat | FG-GAP 4 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 292_357 | 475.3333333333333 | 1003.0 | Repeat | FG-GAP 5 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 32_98 | 475.3333333333333 | 1003.0 | Repeat | FG-GAP 1 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 358_415 | 475.3333333333333 | 1003.0 | Repeat | FG-GAP 6 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 1019_1023 | 521.3333333333334 | 1049.0 | Motif | Note=GFFKR motif |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 1019_1023 | 485.3333333333333 | 1013.0 | Motif | Note=GFFKR motif |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 1019_1023 | 475.3333333333333 | 1003.0 | Motif | Note=GFFKR motif |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 419_482 | 475.3333333333333 | 1003.0 | Repeat | FG-GAP 7 |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 1017_1048 | 521.3333333333334 | 1049.0 | Topological domain | Cytoplasmic |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 31_992 | 521.3333333333334 | 1049.0 | Topological domain | Extracellular |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 1017_1048 | 485.3333333333333 | 1013.0 | Topological domain | Cytoplasmic |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 31_992 | 485.3333333333333 | 1013.0 | Topological domain | Extracellular |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 1017_1048 | 475.3333333333333 | 1003.0 | Topological domain | Cytoplasmic |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 31_992 | 475.3333333333333 | 1003.0 | Topological domain | Extracellular |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000261023 | + | 16 | 30 | 993_1016 | 521.3333333333334 | 1049.0 | Transmembrane | Helical |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000374907 | + | 14 | 28 | 993_1016 | 485.3333333333333 | 1013.0 | Transmembrane | Helical |
Hgene | ITGAV | chr2:187519435 | chr19:12841882 | ENST00000433736 | + | 16 | 30 | 993_1016 | 475.3333333333333 | 1003.0 | Transmembrane | Helical |
Tgene | C19orf43 | chr2:187519435 | chr19:12841882 | ENST00000242784 | 1 | 3 | 20_25 | 141.0 | 177.0 | Compositional bias | Note=Poly-Gly |
Top |
Fusion Protein Structures |
![]() * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
PDB file >>>1271_ITGAV_187519435_C19orf43_12841882_1271_ITGAV_187519435_C19orf43_12841882_ranked_0.pdb | ITGAV | 187519435 | 187519435 | ENST00000242784 | C19orf43 | chr19 | 12841882 | - | MRCCPRPARSAPLVPGGRSEAQPSCLPRSCPGLAEKRAAGKFGRAQAAGRGHWAPRWGGGRWLPLPAWRPARTSAMAFPPRRRLRLGPRG LPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDAT GNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTK ADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYI YDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIA PLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILY | 600 |
Top |
pLDDT score distribution |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
ITGAV_pLDDT.png![]() |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
![]() |
Top |
Ramachandran Plot of Fusion Protein Structure |
![]() |
Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
ITGAV | |
C19orf43 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to ITGAV-C19orf43 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ITGAV-C19orf43 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |