| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:ALK-GALNT14 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: ALK-GALNT14 | FusionPDB ID: 4072 | FusionGDB2.0 ID: 4072 | Hgene | Tgene | Gene symbol | ALK | GALNT14 | Gene ID | 238 | 79623 |
| Gene name | ALK receptor tyrosine kinase | polypeptide N-acetylgalactosaminyltransferase 14 | |
| Synonyms | CD246|NBLST3 | GALNT15|GalNac-T10|GalNac-T14 | |
| Cytomap | 2p23.2-p23.1 | 2p23.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | ALK tyrosine kinase receptorCD246 antigenanaplastic lymphoma receptor tyrosine kinasemutant anaplastic lymphoma kinase | polypeptide N-acetylgalactosaminyltransferase 14UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase T10UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 14 ( | |
| Modification date | 20200329 | 20200313 | |
| UniProtAcc | Q96BT7 | Q96FL9 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000389048, ENST00000498037, ENST00000431873, | ENST00000486564, ENST00000324589, ENST00000349752, ENST00000356174, ENST00000406653, ENST00000420311, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 10 X 13 X 4=520 | 7 X 9 X 5=315 |
| # samples | 10 | 9 | |
| ** MAII score | log2(10/520*10)=-2.37851162325373 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/315*10)=-1.8073549220576 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: ALK [Title/Abstract] AND GALNT14 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ALK(29519754)-GALNT14(31152353), # samples:3 | ||
| Anticipated loss of major functional domain due to fusion event. | ALK-GALNT14 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ALK-GALNT14 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ALK-GALNT14 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ALK-GALNT14 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | ALK | GO:0016310 | phosphorylation | 9174053 |
| Hgene | ALK | GO:0046777 | protein autophosphorylation | 9174053 |
| Fusion gene breakpoints across ALK (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across GALNT14 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | UCEC | TCGA-A5-A2K2-01A | ALK | chr2 | 29519754 | - | GALNT14 | chr2 | 31152353 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000389048 | ALK | chr2 | 29519754 | - | ENST00000324589 | GALNT14 | chr2 | 31152353 | - | 3759 | 2724 | 907 | 3324 | 805 |
| ENST00000389048 | ALK | chr2 | 29519754 | - | ENST00000349752 | GALNT14 | chr2 | 31152353 | - | 3759 | 2724 | 907 | 3324 | 805 |
| ENST00000389048 | ALK | chr2 | 29519754 | - | ENST00000406653 | GALNT14 | chr2 | 31152353 | - | 3758 | 2724 | 907 | 3324 | 805 |
| ENST00000389048 | ALK | chr2 | 29519754 | - | ENST00000356174 | GALNT14 | chr2 | 31152353 | - | 3751 | 2724 | 907 | 3324 | 805 |
| ENST00000389048 | ALK | chr2 | 29519754 | - | ENST00000420311 | GALNT14 | chr2 | 31152353 | - | 3429 | 2724 | 907 | 3324 | 805 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000389048 | ENST00000324589 | ALK | chr2 | 29519754 | - | GALNT14 | chr2 | 31152353 | - | 0.021525323 | 0.9784747 |
| ENST00000389048 | ENST00000349752 | ALK | chr2 | 29519754 | - | GALNT14 | chr2 | 31152353 | - | 0.021525323 | 0.9784747 |
| ENST00000389048 | ENST00000406653 | ALK | chr2 | 29519754 | - | GALNT14 | chr2 | 31152353 | - | 0.021485839 | 0.97851413 |
| ENST00000389048 | ENST00000356174 | ALK | chr2 | 29519754 | - | GALNT14 | chr2 | 31152353 | - | 0.021911731 | 0.97808826 |
| ENST00000389048 | ENST00000420311 | ALK | chr2 | 29519754 | - | GALNT14 | chr2 | 31152353 | - | 0.02638672 | 0.97361326 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >4072_4072_1_ALK-GALNT14_ALK_chr2_29519754_ENST00000389048_GALNT14_chr2_31152353_ENST00000324589_length(amino acids)=805AA_BP=605 MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPPSSSELKAGRPEARGS LALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDF PCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR YIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQ LGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFP APIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDRNTKRTAEVWMDEYKQYYYAARPFA LERPFGNVESRLDLRKNLRCQSFKWYLENIYPELSIPKESSIQKGNIRQRQKCLESQRQNNQETPNLKLSPCAKVKGEDAKSQVWAFTYT -------------------------------------------------------------- >4072_4072_2_ALK-GALNT14_ALK_chr2_29519754_ENST00000389048_GALNT14_chr2_31152353_ENST00000349752_length(amino acids)=805AA_BP=605 MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPPSSSELKAGRPEARGS LALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDF PCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR YIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQ LGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFP APIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDRNTKRTAEVWMDEYKQYYYAARPFA LERPFGNVESRLDLRKNLRCQSFKWYLENIYPELSIPKESSIQKGNIRQRQKCLESQRQNNQETPNLKLSPCAKVKGEDAKSQVWAFTYT -------------------------------------------------------------- >4072_4072_3_ALK-GALNT14_ALK_chr2_29519754_ENST00000389048_GALNT14_chr2_31152353_ENST00000356174_length(amino acids)=805AA_BP=605 MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPPSSSELKAGRPEARGS LALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDF PCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR YIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQ LGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFP APIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDRNTKRTAEVWMDEYKQYYYAARPFA LERPFGNVESRLDLRKNLRCQSFKWYLENIYPELSIPKESSIQKGNIRQRQKCLESQRQNNQETPNLKLSPCAKVKGEDAKSQVWAFTYT -------------------------------------------------------------- >4072_4072_4_ALK-GALNT14_ALK_chr2_29519754_ENST00000389048_GALNT14_chr2_31152353_ENST00000406653_length(amino acids)=805AA_BP=605 MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPPSSSELKAGRPEARGS LALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDF PCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR YIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQ LGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFP APIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDRNTKRTAEVWMDEYKQYYYAARPFA LERPFGNVESRLDLRKNLRCQSFKWYLENIYPELSIPKESSIQKGNIRQRQKCLESQRQNNQETPNLKLSPCAKVKGEDAKSQVWAFTYT -------------------------------------------------------------- >4072_4072_5_ALK-GALNT14_ALK_chr2_29519754_ENST00000389048_GALNT14_chr2_31152353_ENST00000420311_length(amino acids)=805AA_BP=605 MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPPSSSELKAGRPEARGS LALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDF PCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR YIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQ LGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFP APIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDRNTKRTAEVWMDEYKQYYYAARPFA LERPFGNVESRLDLRKNLRCQSFKWYLENIYPELSIPKESSIQKGNIRQRQKCLESQRQNNQETPNLKLSPCAKVKGEDAKSQVWAFTYT -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:29519754/chr2:31152353) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| ALK | GALNT14 |
| FUNCTION: Catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its methyltransferase domain (PubMed:20123966, PubMed:20308323, PubMed:31079898). Catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA (PubMed:20123966, PubMed:20308323). Has a preference for tRNA(Arg) and tRNA(Glu), and does not bind tRNA(Lys)(PubMed:20308323). Binds tRNA and catalyzes the iron and alpha-ketoglutarate dependent hydroxylation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its dioxygenase domain, giving rise to 5-(S)-methoxycarbonylhydroxymethyluridine; has a preference for tRNA(Gly) (PubMed:21285950). Required for normal survival after DNA damage (PubMed:20308323). May inhibit apoptosis and promote cell survival and angiogenesis (PubMed:19293182). {ECO:0000269|PubMed:19293182, ECO:0000269|PubMed:20123966, ECO:0000269|PubMed:20308323, ECO:0000269|PubMed:21285950, ECO:0000269|PubMed:31079898}. | FUNCTION: Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays activity toward mucin-derived peptide substrates such as Muc2, Muc5AC, Muc7, and Muc13 (-58). May be involved in O-glycosylation in kidney. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ALK | chr2:29519754 | chr2:31152353 | ENST00000389048 | - | 9 | 29 | 264_427 | 605.6666666666666 | 1621.0 | Domain | MAM 1 |
| Hgene | ALK | chr2:29519754 | chr2:31152353 | ENST00000389048 | - | 9 | 29 | 437_473 | 605.6666666666666 | 1621.0 | Domain | Note=LDL-receptor class A |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000324589 | 10 | 16 | 415_550 | 357.6666666666667 | 558.0 | Domain | Ricin B-type lectin | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000349752 | 9 | 15 | 415_550 | 352.6666666666667 | 553.0 | Domain | Ricin B-type lectin | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000356174 | 8 | 14 | 415_550 | 319.6666666666667 | 520.0 | Domain | Ricin B-type lectin | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000406653 | 11 | 17 | 415_550 | 332.6666666666667 | 533.0 | Domain | Ricin B-type lectin |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ALK | chr2:29519754 | chr2:31152353 | ENST00000389048 | - | 9 | 29 | 816_940 | 605.6666666666666 | 1621.0 | Compositional bias | Note=Gly-rich |
| Hgene | ALK | chr2:29519754 | chr2:31152353 | ENST00000389048 | - | 9 | 29 | 1116_1392 | 605.6666666666666 | 1621.0 | Domain | Protein kinase |
| Hgene | ALK | chr2:29519754 | chr2:31152353 | ENST00000389048 | - | 9 | 29 | 478_636 | 605.6666666666666 | 1621.0 | Domain | MAM 2 |
| Hgene | ALK | chr2:29519754 | chr2:31152353 | ENST00000389048 | - | 9 | 29 | 1197_1199 | 605.6666666666666 | 1621.0 | Region | Note=Inhibitor binding |
| Hgene | ALK | chr2:29519754 | chr2:31152353 | ENST00000389048 | - | 9 | 29 | 1060_1620 | 605.6666666666666 | 1621.0 | Topological domain | Cytoplasmic |
| Hgene | ALK | chr2:29519754 | chr2:31152353 | ENST00000389048 | - | 9 | 29 | 19_1038 | 605.6666666666666 | 1621.0 | Topological domain | Extracellular |
| Hgene | ALK | chr2:29519754 | chr2:31152353 | ENST00000389048 | - | 9 | 29 | 1039_1059 | 605.6666666666666 | 1621.0 | Transmembrane | Helical |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000324589 | 10 | 16 | 110_215 | 357.6666666666667 | 558.0 | Region | Note=Catalytic subdomain A | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000324589 | 10 | 16 | 274_336 | 357.6666666666667 | 558.0 | Region | Note=Catalytic subdomain B | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000349752 | 9 | 15 | 110_215 | 352.6666666666667 | 553.0 | Region | Note=Catalytic subdomain A | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000349752 | 9 | 15 | 274_336 | 352.6666666666667 | 553.0 | Region | Note=Catalytic subdomain B | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000356174 | 8 | 14 | 110_215 | 319.6666666666667 | 520.0 | Region | Note=Catalytic subdomain A | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000356174 | 8 | 14 | 274_336 | 319.6666666666667 | 520.0 | Region | Note=Catalytic subdomain B | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000406653 | 11 | 17 | 110_215 | 332.6666666666667 | 533.0 | Region | Note=Catalytic subdomain A | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000406653 | 11 | 17 | 274_336 | 332.6666666666667 | 533.0 | Region | Note=Catalytic subdomain B | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000324589 | 10 | 16 | 1_6 | 357.6666666666667 | 558.0 | Topological domain | Cytoplasmic | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000324589 | 10 | 16 | 27_552 | 357.6666666666667 | 558.0 | Topological domain | Lumenal | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000349752 | 9 | 15 | 1_6 | 352.6666666666667 | 553.0 | Topological domain | Cytoplasmic | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000349752 | 9 | 15 | 27_552 | 352.6666666666667 | 553.0 | Topological domain | Lumenal | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000356174 | 8 | 14 | 1_6 | 319.6666666666667 | 520.0 | Topological domain | Cytoplasmic | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000356174 | 8 | 14 | 27_552 | 319.6666666666667 | 520.0 | Topological domain | Lumenal | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000406653 | 11 | 17 | 1_6 | 332.6666666666667 | 533.0 | Topological domain | Cytoplasmic | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000406653 | 11 | 17 | 27_552 | 332.6666666666667 | 533.0 | Topological domain | Lumenal | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000324589 | 10 | 16 | 7_26 | 357.6666666666667 | 558.0 | Transmembrane | Helical%3B Signal-anchor for type II membrane protein | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000349752 | 9 | 15 | 7_26 | 352.6666666666667 | 553.0 | Transmembrane | Helical%3B Signal-anchor for type II membrane protein | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000356174 | 8 | 14 | 7_26 | 319.6666666666667 | 520.0 | Transmembrane | Helical%3B Signal-anchor for type II membrane protein | |
| Tgene | GALNT14 | chr2:29519754 | chr2:31152353 | ENST00000406653 | 11 | 17 | 7_26 | 332.6666666666667 | 533.0 | Transmembrane | Helical%3B Signal-anchor for type II membrane protein |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| ALK |  |
| GALNT14 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to ALK-GALNT14 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ALK-GALNT14 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | ALK | C0007131 | Non-Small Cell Lung Carcinoma | 28 | CGI;CTD_human |
| Hgene | ALK | C0027819 | Neuroblastoma | 13 | CGI;CTD_human;ORPHANET |
| Hgene | ALK | C0152013 | Adenocarcinoma of lung (disorder) | 8 | CGI;CTD_human |
| Hgene | ALK | C2751681 | NEUROBLASTOMA, SUSCEPTIBILITY TO, 3 | 8 | CLINGEN;UNIPROT |
| Hgene | ALK | C0206180 | Ki-1+ Anaplastic Large Cell Lymphoma | 6 | CGI;CTD_human |
| Hgene | ALK | C0334121 | Inflammatory Myofibroblastic Tumor | 4 | CGI;CTD_human;ORPHANET |
| Hgene | ALK | C0018199 | Granuloma, Plasma Cell | 3 | CTD_human |
| Hgene | ALK | C0007621 | Neoplastic Cell Transformation | 2 | CTD_human |
| Hgene | ALK | C0027627 | Neoplasm Metastasis | 2 | CTD_human |
| Hgene | ALK | C0238463 | Papillary thyroid carcinoma | 2 | ORPHANET |
| Hgene | ALK | C0001973 | Alcoholic Intoxication, Chronic | 1 | PSYGENET |
| Hgene | ALK | C0006118 | Brain Neoplasms | 1 | CGI;CTD_human |
| Hgene | ALK | C0006142 | Malignant neoplasm of breast | 1 | CTD_human |
| Hgene | ALK | C0007134 | Renal Cell Carcinoma | 1 | CTD_human |
| Hgene | ALK | C0011570 | Mental Depression | 1 | PSYGENET |
| Hgene | ALK | C0011581 | Depressive disorder | 1 | PSYGENET |
| Hgene | ALK | C0027643 | Neoplasm Recurrence, Local | 1 | CTD_human |
| Hgene | ALK | C0036341 | Schizophrenia | 1 | PSYGENET |
| Hgene | ALK | C0079744 | Diffuse Large B-Cell Lymphoma | 1 | CTD_human |
| Hgene | ALK | C0085269 | Plasma Cell Granuloma, Pulmonary | 1 | CTD_human |
| Hgene | ALK | C0153633 | Malignant neoplasm of brain | 1 | CGI;CTD_human |
| Hgene | ALK | C0278601 | Inflammatory Breast Carcinoma | 1 | CTD_human |
| Hgene | ALK | C0279702 | Conventional (Clear Cell) Renal Cell Carcinoma | 1 | CTD_human |
| Hgene | ALK | C0496899 | Benign neoplasm of brain, unspecified | 1 | CTD_human |
| Hgene | ALK | C0678222 | Breast Carcinoma | 1 | CTD_human |
| Hgene | ALK | C0750974 | Brain Tumor, Primary | 1 | CTD_human |
| Hgene | ALK | C0750977 | Recurrent Brain Neoplasm | 1 | CTD_human |
| Hgene | ALK | C0750979 | Primary malignant neoplasm of brain | 1 | CTD_human |
| Hgene | ALK | C1257931 | Mammary Neoplasms, Human | 1 | CTD_human |
| Hgene | ALK | C1266042 | Chromophobe Renal Cell Carcinoma | 1 | CTD_human |
| Hgene | ALK | C1266043 | Sarcomatoid Renal Cell Carcinoma | 1 | CTD_human |
| Hgene | ALK | C1266044 | Collecting Duct Carcinoma of the Kidney | 1 | CTD_human |
| Hgene | ALK | C1306837 | Papillary Renal Cell Carcinoma | 1 | CTD_human |
| Hgene | ALK | C1332079 | Anaplastic Large Cell Lymphoma, ALK-Positive | 1 | ORPHANET |
| Hgene | ALK | C1458155 | Mammary Neoplasms | 1 | CTD_human |
| Hgene | ALK | C1527390 | Neoplasms, Intracranial | 1 | CTD_human |
| Hgene | ALK | C2931189 | Neural crest tumor | 1 | ORPHANET |
| Hgene | ALK | C3899155 | hereditary neuroblastoma | 1 | GENOMICS_ENGLAND |
| Hgene | ALK | C4704874 | Mammary Carcinoma, Human | 1 | CTD_human |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies