UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:ALK-SCEL |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: ALK-SCEL | FusionPDB ID: 4080 | FusionGDB2.0 ID: 4080 | Hgene | Tgene | Gene symbol | ALK | SCEL | Gene ID | 238 | 8796 |
Gene name | ALK receptor tyrosine kinase | sciellin | |
Synonyms | CD246|NBLST3 | - | |
Cytomap | 2p23.2-p23.1 | 13q22.3 | |
Type of gene | protein-coding | protein-coding | |
Description | ALK tyrosine kinase receptorCD246 antigenanaplastic lymphoma receptor tyrosine kinasemutant anaplastic lymphoma kinase | sciellin | |
Modification date | 20200329 | 20200313 | |
UniProtAcc | Q96BT7 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000389048, ENST00000431873, ENST00000498037, | ENST00000469982, ENST00000349847, ENST00000377246, ENST00000535157, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 10 X 13 X 4=520 | 7 X 7 X 5=245 |
# samples | 10 | 8 | |
** MAII score | log2(10/520*10)=-2.37851162325373 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(8/245*10)=-1.61470984411521 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: ALK [Title/Abstract] AND SCEL [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ALK(29754781)-SCEL(78202082), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | ALK-SCEL seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ALK-SCEL seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ALK-SCEL seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ALK-SCEL seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ALK | GO:0016310 | phosphorylation | 9174053 |
Hgene | ALK | GO:0046777 | protein autophosphorylation | 9174053 |
Tgene | SCEL | GO:0030216 | keratinocyte differentiation | 14632196 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | UCEC | TCGA-EO-A3AS-01A | ALK | chr2 | 29754781 | - | SCEL | chr13 | 78202082 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000389048 | ALK | chr2 | 29754781 | - | ENST00000535157 | SCEL | chr13 | 78202082 | + | 3485 | 2061 | 907 | 2499 | 530 |
ENST00000389048 | ALK | chr2 | 29754781 | - | ENST00000377246 | SCEL | chr13 | 78202082 | + | 3489 | 2061 | 907 | 2499 | 530 |
ENST00000389048 | ALK | chr2 | 29754781 | - | ENST00000349847 | SCEL | chr13 | 78202082 | + | 2735 | 2061 | 907 | 2499 | 530 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000389048 | ENST00000535157 | ALK | chr2 | 29754781 | - | SCEL | chr13 | 78202082 | + | 0.024394816 | 0.97560513 |
ENST00000389048 | ENST00000377246 | ALK | chr2 | 29754781 | - | SCEL | chr13 | 78202082 | + | 0.024465661 | 0.9755343 |
ENST00000389048 | ENST00000349847 | ALK | chr2 | 29754781 | - | SCEL | chr13 | 78202082 | + | 0.068868324 | 0.93113166 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >4080_4080_1_ALK-SCEL_ALK_chr2_29754781_ENST00000389048_SCEL_chr13_78202082_ENST00000349847_length(amino acids)=530AA_BP=385 MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPPSSSELKAGRPEARGS LALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDF PCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR YIAQLLPHNEAAREILLMPTPGKHGDQNLENLIEVNSHVSENKNGSSNTGAKQAGPQDTVVYTRTYVENSKSPKDGYQENISGKYIQTVY -------------------------------------------------------------- >4080_4080_2_ALK-SCEL_ALK_chr2_29754781_ENST00000389048_SCEL_chr13_78202082_ENST00000377246_length(amino acids)=530AA_BP=385 MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPPSSSELKAGRPEARGS LALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDF PCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR YIAQLLPHNEAAREILLMPTPGKHGDQNLENLIEVNSHVSENKNGSSNTGAKQAGPQDTVVYTRTYVENSKSPKDGYQENISGKYIQTVY -------------------------------------------------------------- >4080_4080_3_ALK-SCEL_ALK_chr2_29754781_ENST00000389048_SCEL_chr13_78202082_ENST00000535157_length(amino acids)=530AA_BP=385 MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARDLLLPPSSSELKAGRPEARGS LALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDF PCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR YIAQLLPHNEAAREILLMPTPGKHGDQNLENLIEVNSHVSENKNGSSNTGAKQAGPQDTVVYTRTYVENSKSPKDGYQENISGKYIQTVY -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:29754781/chr13:78202082) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
ALK | . |
FUNCTION: Catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its methyltransferase domain (PubMed:20123966, PubMed:20308323, PubMed:31079898). Catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA (PubMed:20123966, PubMed:20308323). Has a preference for tRNA(Arg) and tRNA(Glu), and does not bind tRNA(Lys)(PubMed:20308323). Binds tRNA and catalyzes the iron and alpha-ketoglutarate dependent hydroxylation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its dioxygenase domain, giving rise to 5-(S)-methoxycarbonylhydroxymethyluridine; has a preference for tRNA(Gly) (PubMed:21285950). Required for normal survival after DNA damage (PubMed:20308323). May inhibit apoptosis and promote cell survival and angiogenesis (PubMed:19293182). {ECO:0000269|PubMed:19293182, ECO:0000269|PubMed:20123966, ECO:0000269|PubMed:20308323, ECO:0000269|PubMed:21285950, ECO:0000269|PubMed:31079898}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 619_685 | 542.6666666666666 | 689.0 | Domain | LIM zinc-binding | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 619_685 | 522.6666666666666 | 669.0 | Domain | LIM zinc-binding | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 619_685 | 500.6666666666667 | 647.0 | Domain | LIM zinc-binding | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 544_563 | 542.6666666666666 | 689.0 | Repeat | Note=16 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 524_543 | 522.6666666666666 | 669.0 | Repeat | Note=15 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 544_563 | 522.6666666666666 | 669.0 | Repeat | Note=16 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 505_523 | 500.6666666666667 | 647.0 | Repeat | Note=14 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 524_543 | 500.6666666666667 | 647.0 | Repeat | Note=15 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 544_563 | 500.6666666666667 | 647.0 | Repeat | Note=16 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ALK | chr2:29754781 | chr13:78202082 | ENST00000389048 | - | 4 | 29 | 816_940 | 384.6666666666667 | 1621.0 | Compositional bias | Note=Gly-rich |
Hgene | ALK | chr2:29754781 | chr13:78202082 | ENST00000389048 | - | 4 | 29 | 1116_1392 | 384.6666666666667 | 1621.0 | Domain | Protein kinase |
Hgene | ALK | chr2:29754781 | chr13:78202082 | ENST00000389048 | - | 4 | 29 | 264_427 | 384.6666666666667 | 1621.0 | Domain | MAM 1 |
Hgene | ALK | chr2:29754781 | chr13:78202082 | ENST00000389048 | - | 4 | 29 | 437_473 | 384.6666666666667 | 1621.0 | Domain | Note=LDL-receptor class A |
Hgene | ALK | chr2:29754781 | chr13:78202082 | ENST00000389048 | - | 4 | 29 | 478_636 | 384.6666666666667 | 1621.0 | Domain | MAM 2 |
Hgene | ALK | chr2:29754781 | chr13:78202082 | ENST00000389048 | - | 4 | 29 | 1197_1199 | 384.6666666666667 | 1621.0 | Region | Note=Inhibitor binding |
Hgene | ALK | chr2:29754781 | chr13:78202082 | ENST00000389048 | - | 4 | 29 | 1060_1620 | 384.6666666666667 | 1621.0 | Topological domain | Cytoplasmic |
Hgene | ALK | chr2:29754781 | chr13:78202082 | ENST00000389048 | - | 4 | 29 | 19_1038 | 384.6666666666667 | 1621.0 | Topological domain | Extracellular |
Hgene | ALK | chr2:29754781 | chr13:78202082 | ENST00000389048 | - | 4 | 29 | 1039_1059 | 384.6666666666667 | 1621.0 | Transmembrane | Helical |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 251_563 | 542.6666666666666 | 689.0 | Region | Note=16 X approximate tandem repeats | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 251_563 | 522.6666666666666 | 669.0 | Region | Note=16 X approximate tandem repeats | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 251_563 | 500.6666666666667 | 647.0 | Region | Note=16 X approximate tandem repeats | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 251_266 | 542.6666666666666 | 689.0 | Repeat | Note=1 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 267_286 | 542.6666666666666 | 689.0 | Repeat | Note=2 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 287_306 | 542.6666666666666 | 689.0 | Repeat | Note=3 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 307_326 | 542.6666666666666 | 689.0 | Repeat | Note=4 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 327_346 | 542.6666666666666 | 689.0 | Repeat | Note=5 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 347_366 | 542.6666666666666 | 689.0 | Repeat | Note=6 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 387_406 | 542.6666666666666 | 689.0 | Repeat | Note=8 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 407_426 | 542.6666666666666 | 689.0 | Repeat | Note=9 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 427_446 | 542.6666666666666 | 689.0 | Repeat | Note=10 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 447_465 | 542.6666666666666 | 689.0 | Repeat | Note=11 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 466_484 | 542.6666666666666 | 689.0 | Repeat | Note=12 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 485_504 | 542.6666666666666 | 689.0 | Repeat | Note=13 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 505_523 | 542.6666666666666 | 689.0 | Repeat | Note=14 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000349847 | 26 | 33 | 524_543 | 542.6666666666666 | 689.0 | Repeat | Note=15 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 251_266 | 522.6666666666666 | 669.0 | Repeat | Note=1 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 267_286 | 522.6666666666666 | 669.0 | Repeat | Note=2 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 287_306 | 522.6666666666666 | 669.0 | Repeat | Note=3 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 307_326 | 522.6666666666666 | 669.0 | Repeat | Note=4 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 327_346 | 522.6666666666666 | 669.0 | Repeat | Note=5 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 347_366 | 522.6666666666666 | 669.0 | Repeat | Note=6 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 387_406 | 522.6666666666666 | 669.0 | Repeat | Note=8 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 407_426 | 522.6666666666666 | 669.0 | Repeat | Note=9 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 427_446 | 522.6666666666666 | 669.0 | Repeat | Note=10 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 447_465 | 522.6666666666666 | 669.0 | Repeat | Note=11 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 466_484 | 522.6666666666666 | 669.0 | Repeat | Note=12 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 485_504 | 522.6666666666666 | 669.0 | Repeat | Note=13 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000377246 | 25 | 32 | 505_523 | 522.6666666666666 | 669.0 | Repeat | Note=14 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 251_266 | 500.6666666666667 | 647.0 | Repeat | Note=1 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 267_286 | 500.6666666666667 | 647.0 | Repeat | Note=2 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 287_306 | 500.6666666666667 | 647.0 | Repeat | Note=3 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 307_326 | 500.6666666666667 | 647.0 | Repeat | Note=4 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 327_346 | 500.6666666666667 | 647.0 | Repeat | Note=5 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 347_366 | 500.6666666666667 | 647.0 | Repeat | Note=6 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 387_406 | 500.6666666666667 | 647.0 | Repeat | Note=8 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 407_426 | 500.6666666666667 | 647.0 | Repeat | Note=9 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 427_446 | 500.6666666666667 | 647.0 | Repeat | Note=10 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 447_465 | 500.6666666666667 | 647.0 | Repeat | Note=11 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 466_484 | 500.6666666666667 | 647.0 | Repeat | Note=12 | |
Tgene | SCEL | chr2:29754781 | chr13:78202082 | ENST00000535157 | 24 | 31 | 485_504 | 500.6666666666667 | 647.0 | Repeat | Note=13 |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
ALK | ![]() |
SCEL |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to ALK-SCEL |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ALK-SCEL |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | ALK | C0007131 | Non-Small Cell Lung Carcinoma | 28 | CGI;CTD_human |
Hgene | ALK | C0027819 | Neuroblastoma | 13 | CGI;CTD_human;ORPHANET |
Hgene | ALK | C0152013 | Adenocarcinoma of lung (disorder) | 8 | CGI;CTD_human |
Hgene | ALK | C2751681 | NEUROBLASTOMA, SUSCEPTIBILITY TO, 3 | 8 | CLINGEN;UNIPROT |
Hgene | ALK | C0206180 | Ki-1+ Anaplastic Large Cell Lymphoma | 6 | CGI;CTD_human |
Hgene | ALK | C0334121 | Inflammatory Myofibroblastic Tumor | 4 | CGI;CTD_human;ORPHANET |
Hgene | ALK | C0018199 | Granuloma, Plasma Cell | 3 | CTD_human |
Hgene | ALK | C0007621 | Neoplastic Cell Transformation | 2 | CTD_human |
Hgene | ALK | C0027627 | Neoplasm Metastasis | 2 | CTD_human |
Hgene | ALK | C0238463 | Papillary thyroid carcinoma | 2 | ORPHANET |
Hgene | ALK | C0001973 | Alcoholic Intoxication, Chronic | 1 | PSYGENET |
Hgene | ALK | C0006118 | Brain Neoplasms | 1 | CGI;CTD_human |
Hgene | ALK | C0006142 | Malignant neoplasm of breast | 1 | CTD_human |
Hgene | ALK | C0007134 | Renal Cell Carcinoma | 1 | CTD_human |
Hgene | ALK | C0011570 | Mental Depression | 1 | PSYGENET |
Hgene | ALK | C0011581 | Depressive disorder | 1 | PSYGENET |
Hgene | ALK | C0027643 | Neoplasm Recurrence, Local | 1 | CTD_human |
Hgene | ALK | C0036341 | Schizophrenia | 1 | PSYGENET |
Hgene | ALK | C0079744 | Diffuse Large B-Cell Lymphoma | 1 | CTD_human |
Hgene | ALK | C0085269 | Plasma Cell Granuloma, Pulmonary | 1 | CTD_human |
Hgene | ALK | C0153633 | Malignant neoplasm of brain | 1 | CGI;CTD_human |
Hgene | ALK | C0278601 | Inflammatory Breast Carcinoma | 1 | CTD_human |
Hgene | ALK | C0279702 | Conventional (Clear Cell) Renal Cell Carcinoma | 1 | CTD_human |
Hgene | ALK | C0496899 | Benign neoplasm of brain, unspecified | 1 | CTD_human |
Hgene | ALK | C0678222 | Breast Carcinoma | 1 | CTD_human |
Hgene | ALK | C0750974 | Brain Tumor, Primary | 1 | CTD_human |
Hgene | ALK | C0750977 | Recurrent Brain Neoplasm | 1 | CTD_human |
Hgene | ALK | C0750979 | Primary malignant neoplasm of brain | 1 | CTD_human |
Hgene | ALK | C1257931 | Mammary Neoplasms, Human | 1 | CTD_human |
Hgene | ALK | C1266042 | Chromophobe Renal Cell Carcinoma | 1 | CTD_human |
Hgene | ALK | C1266043 | Sarcomatoid Renal Cell Carcinoma | 1 | CTD_human |
Hgene | ALK | C1266044 | Collecting Duct Carcinoma of the Kidney | 1 | CTD_human |
Hgene | ALK | C1306837 | Papillary Renal Cell Carcinoma | 1 | CTD_human |
Hgene | ALK | C1332079 | Anaplastic Large Cell Lymphoma, ALK-Positive | 1 | ORPHANET |
Hgene | ALK | C1458155 | Mammary Neoplasms | 1 | CTD_human |
Hgene | ALK | C1527390 | Neoplasms, Intracranial | 1 | CTD_human |
Hgene | ALK | C2931189 | Neural crest tumor | 1 | ORPHANET |
Hgene | ALK | C3899155 | hereditary neuroblastoma | 1 | GENOMICS_ENGLAND |
Hgene | ALK | C4704874 | Mammary Carcinoma, Human | 1 | CTD_human |