UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:KDM5B-KLHL12 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: KDM5B-KLHL12 | FusionPDB ID: 41862 | FusionGDB2.0 ID: 41862 | Hgene | Tgene | Gene symbol | KDM5B | KLHL12 | Gene ID | 10765 | 59349 |
Gene name | lysine demethylase 5B | kelch like family member 12 | |
Synonyms | CT31|JARID1B|MRT65|PLU-1|PLU1|PPP1R98|PUT1|RBBP2H1A|RBP2-H1 | C3IP1|DKIR | |
Cytomap | 1q32.1 | 1q32.1 | |
Type of gene | protein-coding | protein-coding | |
Description | lysine-specific demethylase 5Bcancer/testis antigen 31histone demethylase JARID1Bjumonji, AT rich interactive domain 1Bjumonji/ARID domain-containing protein 1Blysine (K)-specific demethylase 5Bprotein phosphatase 1, regulatory subunit 98putative D | kelch-like protein 12CUL3-interacting protein 1DKIR homologkelch-like protein C3IP1 | |
Modification date | 20200320 | 20200327 | |
UniProtAcc | Q9UGL1 | Q53G59 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000367264, ENST00000367265, ENST00000456180, | ENST00000367259, ENST00000435533, ENST00000367261, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 14 X 13 X 9=1638 | 5 X 5 X 3=75 |
# samples | 17 | 5 | |
** MAII score | log2(17/1638*10)=-3.26832870550331 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(5/75*10)=-0.584962500721156 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: KDM5B [Title/Abstract] AND KLHL12 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | KDM5B(202742246)-KLHL12(202880331), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | KDM5B-KLHL12 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. KDM5B-KLHL12 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. KDM5B-KLHL12 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. KDM5B-KLHL12 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | KDM5B | GO:0034720 | histone H3-K4 demethylation | 20228790 |
Tgene | KLHL12 | GO:0006513 | protein monoubiquitination | 22358839|27716508 |
Tgene | KLHL12 | GO:0006888 | ER to Golgi vesicle-mediated transport | 22358839 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-CG-5717-01A | KDM5B | chr1 | 202742246 | - | KLHL12 | chr1 | 202880331 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000367265 | KDM5B | chr1 | 202742246 | - | ENST00000367261 | KLHL12 | chr1 | 202880331 | - | 4314 | 1741 | 934 | 2880 | 648 |
ENST00000367264 | KDM5B | chr1 | 202742246 | - | ENST00000367261 | KLHL12 | chr1 | 202880331 | - | 3262 | 689 | 113 | 1828 | 571 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000367265 | ENST00000367261 | KDM5B | chr1 | 202742246 | - | KLHL12 | chr1 | 202880331 | - | 0.001224299 | 0.99877566 |
ENST00000367264 | ENST00000367261 | KDM5B | chr1 | 202742246 | - | KLHL12 | chr1 | 202880331 | - | 0.001006995 | 0.998993 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >41862_41862_1_KDM5B-KLHL12_KDM5B_chr1_202742246_ENST00000367264_KLHL12_chr1_202880331_ENST00000367261_length(amino acids)=571AA_BP=183 MEAATTLHPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRL NELEAQTRVKLNFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILN PYNLFLSGDSLRVDSEEPVFEAVINWVKHAKKEREESLPNLLQYVRMPLLTPRYITDVIDAEPFIRCSLQCRDLVDEAKKFHLRPELRSQ MQGPRTRARLGANEVLLVVGGFGSQQSPIDVVEKYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDG VWYSVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGVIYCLGGYDGLNILNSVEKYD PHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSI -------------------------------------------------------------- >41862_41862_2_KDM5B-KLHL12_KDM5B_chr1_202742246_ENST00000367265_KLHL12_chr1_202880331_ENST00000367261_length(amino acids)=648AA_BP=260 MGVGWDSFSSPWRRRRTAWACGETSSSEAEKAQGAAVARTTRTCCCSSRVCTGLGPSGARSLGPGAHLRLALAQPAVMEAATTLHPGPRP ALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLNF LDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRV DSEEPVFEAVINWVKHAKKEREESLPNLLQYVRMPLLTPRYITDVIDAEPFIRCSLQCRDLVDEAKKFHLRPELRSQMQGPRTRARLGAN EVLLVVGGFGSQQSPIDVVEKYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMNVRRG LAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAGLVVASGVIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMA TKRSGAGVALLNDHIYVVGGFDGTAHLSSVEAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVV -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:202742246/chr1:202880331) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
KDM5B | KLHL12 |
FUNCTION: Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code (PubMed:24952722, PubMed:27214403, PubMed:28262558). Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5 (PubMed:24952722). In contrast, may act as a tumor suppressor for melanoma. Represses the CLOCK-ARNTL/BMAL1 heterodimer-mediated transcriptional activation of the core clock component PER2 (By similarity). {ECO:0000250|UniProtKB:Q80Y84, ECO:0000269|PubMed:12657635, ECO:0000269|PubMed:16645588, ECO:0000269|PubMed:17320161, ECO:0000269|PubMed:17363312, ECO:0000269|PubMed:24952722, ECO:0000269|PubMed:26645689, ECO:0000269|PubMed:26741168, ECO:0000269|PubMed:27214403, ECO:0000269|PubMed:28262558}. | FUNCTION: Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a negative regulator of Wnt signaling pathway and ER-Golgi transport (PubMed:22358839, PubMed:27565346). The BCR(KLHL12) complex is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31 (SEC31A or SEC31B) (PubMed:22358839, PubMed:27565346). The BCR(KLHL12) complex is also involved in neural crest specification: in response to cytosolic calcium increase, interacts with the heterodimer formed with PEF1 and PDCD6/ALG-2, leading to bridge together the BCR(KLHL12) complex and SEC31 (SEC31A or SEC31B), promoting monoubiquitination of SEC31 and subsequent collagen export (PubMed:27716508). As part of the BCR(KLHL12) complex, also acts as a negative regulator of the Wnt signaling pathway by mediating ubiquitination and subsequent proteolysis of DVL3 (PubMed:16547521). The BCR(KLHL12) complex also mediates polyubiquitination of DRD4 and PEF1, without leading to degradation of these proteins (PubMed:18303015, PubMed:20100572, PubMed:27716508). {ECO:0000269|PubMed:16547521, ECO:0000269|PubMed:18303015, ECO:0000269|PubMed:20100572, ECO:0000269|PubMed:22358839, ECO:0000269|PubMed:27565346, ECO:0000269|PubMed:27716508}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367264 | - | 4 | 28 | 32_73 | 192.0 | 1581.0 | Domain | JmjN |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367264 | - | 4 | 28 | 97_187 | 192.0 | 1581.0 | Domain | ARID |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367265 | - | 4 | 27 | 32_73 | 192.0 | 1545.0 | Domain | JmjN |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367265 | - | 4 | 27 | 97_187 | 192.0 | 1545.0 | Domain | ARID |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000367261 | 3 | 12 | 282_329 | 189.0 | 569.0 | Repeat | Note=Kelch 1 | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000367261 | 3 | 12 | 331_379 | 189.0 | 569.0 | Repeat | Note=Kelch 2 | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000367261 | 3 | 12 | 380_426 | 189.0 | 569.0 | Repeat | Note=Kelch 3 | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000367261 | 3 | 12 | 427_473 | 189.0 | 569.0 | Repeat | Note=Kelch 4 | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000367261 | 3 | 12 | 475_520 | 189.0 | 569.0 | Repeat | Note=Kelch 5 | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000367261 | 3 | 12 | 522_567 | 189.0 | 569.0 | Repeat | Note=Kelch 6 | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000435533 | 3 | 12 | 282_329 | 227.0 | 607.0 | Repeat | Note=Kelch 1 | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000435533 | 3 | 12 | 331_379 | 227.0 | 607.0 | Repeat | Note=Kelch 2 | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000435533 | 3 | 12 | 380_426 | 227.0 | 607.0 | Repeat | Note=Kelch 3 | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000435533 | 3 | 12 | 427_473 | 227.0 | 607.0 | Repeat | Note=Kelch 4 | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000435533 | 3 | 12 | 475_520 | 227.0 | 607.0 | Repeat | Note=Kelch 5 | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000435533 | 3 | 12 | 522_567 | 227.0 | 607.0 | Repeat | Note=Kelch 6 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367264 | - | 4 | 28 | 1434_1439 | 192.0 | 1581.0 | Compositional bias | Note=Poly-Lys |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367265 | - | 4 | 27 | 1434_1439 | 192.0 | 1545.0 | Compositional bias | Note=Poly-Lys |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367264 | - | 4 | 28 | 453_619 | 192.0 | 1581.0 | Domain | JmjC |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367265 | - | 4 | 27 | 453_619 | 192.0 | 1545.0 | Domain | JmjC |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367264 | - | 4 | 28 | 1176_1224 | 192.0 | 1581.0 | Zinc finger | PHD-type 2 |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367264 | - | 4 | 28 | 1484_1538 | 192.0 | 1581.0 | Zinc finger | PHD-type 3 |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367264 | - | 4 | 28 | 309_359 | 192.0 | 1581.0 | Zinc finger | PHD-type 1 |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367264 | - | 4 | 28 | 692_744 | 192.0 | 1581.0 | Zinc finger | C5HC2 |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367265 | - | 4 | 27 | 1176_1224 | 192.0 | 1545.0 | Zinc finger | PHD-type 2 |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367265 | - | 4 | 27 | 1484_1538 | 192.0 | 1545.0 | Zinc finger | PHD-type 3 |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367265 | - | 4 | 27 | 309_359 | 192.0 | 1545.0 | Zinc finger | PHD-type 1 |
Hgene | KDM5B | chr1:202742246 | chr1:202880331 | ENST00000367265 | - | 4 | 27 | 692_744 | 192.0 | 1545.0 | Zinc finger | C5HC2 |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000367261 | 3 | 12 | 135_236 | 189.0 | 569.0 | Domain | Note=BACK | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000367261 | 3 | 12 | 33_100 | 189.0 | 569.0 | Domain | BTB | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000435533 | 3 | 12 | 135_236 | 227.0 | 607.0 | Domain | Note=BACK | |
Tgene | KLHL12 | chr1:202742246 | chr1:202880331 | ENST00000435533 | 3 | 12 | 33_100 | 227.0 | 607.0 | Domain | BTB |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
KDM5B | |
KLHL12 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to KDM5B-KLHL12 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to KDM5B-KLHL12 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |