UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:KIAA0232-INPP4B |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: KIAA0232-INPP4B | FusionPDB ID: 42060 | FusionGDB2.0 ID: 42060 | Hgene | Tgene | Gene symbol | KIAA0232 | INPP4B | Gene ID | 9778 | 8821 |
Gene name | KIAA0232 | inositol polyphosphate-4-phosphatase type II B | |
Synonyms | - | - | |
Cytomap | 4p16.1 | 4q31.21 | |
Type of gene | protein-coding | protein-coding | |
Description | uncharacterized protein KIAA0232 | inositol polyphosphate 4-phosphatase type IIinositol polyphosphate 4-phosphatase II; 4-phosphatase IIinositol polyphosphate-4-phosphatase, type II, 105kDatype II inositol 3,4-bisphosphate 4-phosphatase | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q92628 | O15327 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000307659, ENST00000425103, ENST00000503278, | ENST00000262992, ENST00000308502, ENST00000506217, ENST00000507861, ENST00000508084, ENST00000508116, ENST00000509777, ENST00000513000, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 12 X 8 X 5=480 | 12 X 11 X 6=792 |
# samples | 16 | 13 | |
** MAII score | log2(16/480*10)=-1.58496250072116 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(13/792*10)=-2.60698880705116 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: KIAA0232 [Title/Abstract] AND INPP4B [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | KIAA0232(6826411)-INPP4B(142950067), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | KIAA0232-INPP4B seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. KIAA0232-INPP4B seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. KIAA0232-INPP4B seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. KIAA0232-INPP4B seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-LL-A441-01A | KIAA0232 | chr4 | 6826411 | - | INPP4B | chr4 | 142950067 | - |
ChimerDB4 | BRCA | TCGA-LL-A441-01A | KIAA0232 | chr4 | 6826411 | + | INPP4B | chr4 | 142950067 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000425103 | KIAA0232 | chr4 | 6826411 | + | ENST00000513000 | INPP4B | chr4 | 142950067 | - | 6365 | 610 | 3119 | 2724 | 131 |
ENST00000307659 | KIAA0232 | chr4 | 6826411 | + | ENST00000513000 | INPP4B | chr4 | 142950067 | - | 6441 | 686 | 3195 | 2800 | 131 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000425103 | ENST00000513000 | KIAA0232 | chr4 | 6826411 | + | INPP4B | chr4 | 142950067 | - | 0.017679317 | 0.98232067 |
ENST00000307659 | ENST00000513000 | KIAA0232 | chr4 | 6826411 | + | INPP4B | chr4 | 142950067 | - | 0.017887466 | 0.9821125 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >42060_42060_1_KIAA0232-INPP4B_KIAA0232_chr4_6826411_ENST00000307659_INPP4B_chr4_142950067_ENST00000513000_length(amino acids)=131AA_BP= MKIHKHLYYSKHYNLRLLYYSFIYLFKDGVSLFSPRLECNGMISAHCNLRLRGSSDSLASASQVAGITRVCHHIQLIFVSLVEMGFHHVG -------------------------------------------------------------- >42060_42060_2_KIAA0232-INPP4B_KIAA0232_chr4_6826411_ENST00000425103_INPP4B_chr4_142950067_ENST00000513000_length(amino acids)=131AA_BP= MKIHKHLYYSKHYNLRLLYYSFIYLFKDGVSLFSPRLECNGMISAHCNLRLRGSSDSLASASQVAGITRVCHHIQLIFVSLVEMGFHHVG -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr4:6826411/chr4:142950067) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
KIAA0232 | INPP4B |
FUNCTION: Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-trisphosphate (PubMed:24070612, PubMed:24591580). Plays a role in the late stages of macropinocytosis by dephosphorylating phosphatidylinositol 3,4-bisphosphate in membrane ruffles (PubMed:24591580). The lipid phosphatase activity is critical for tumor suppressor function. Antagonizes the PI3K-AKT/PKB signaling pathway by dephosphorylating phosphoinositides and thereby modulating cell cycle progression and cell survival (PubMed:19647222, PubMed:24070612). {ECO:0000269|PubMed:19647222, ECO:0000269|PubMed:24070612, ECO:0000269|PubMed:24591580}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | KIAA0232 | chr4:6826411 | chr4:142950067 | ENST00000307659 | + | 3 | 10 | 14_20 | 77.0 | 1396.0 | Compositional bias | Note=Poly-Ser |
Hgene | KIAA0232 | chr4:6826411 | chr4:142950067 | ENST00000425103 | + | 2 | 9 | 14_20 | 77.0 | 1396.0 | Compositional bias | Note=Poly-Ser |
Tgene | INPP4B | chr4:6826411 | chr4:142950067 | ENST00000506217 | 0 | 5 | 23_165 | 0.0 | 132.0 | Domain | C2 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | KIAA0232 | chr4:6826411 | chr4:142950067 | ENST00000307659 | + | 3 | 10 | 202_210 | 77.0 | 1396.0 | Compositional bias | Note=Poly-Ser |
Hgene | KIAA0232 | chr4:6826411 | chr4:142950067 | ENST00000307659 | + | 3 | 10 | 350_358 | 77.0 | 1396.0 | Compositional bias | Note=Poly-Ser |
Hgene | KIAA0232 | chr4:6826411 | chr4:142950067 | ENST00000425103 | + | 2 | 9 | 202_210 | 77.0 | 1396.0 | Compositional bias | Note=Poly-Ser |
Hgene | KIAA0232 | chr4:6826411 | chr4:142950067 | ENST00000425103 | + | 2 | 9 | 350_358 | 77.0 | 1396.0 | Compositional bias | Note=Poly-Ser |
Hgene | KIAA0232 | chr4:6826411 | chr4:142950067 | ENST00000307659 | + | 3 | 10 | 89_96 | 77.0 | 1396.0 | Nucleotide binding | ATP |
Hgene | KIAA0232 | chr4:6826411 | chr4:142950067 | ENST00000425103 | + | 2 | 9 | 89_96 | 77.0 | 1396.0 | Nucleotide binding | ATP |
Tgene | INPP4B | chr4:6826411 | chr4:142950067 | ENST00000262992 | 22 | 24 | 23_165 | 880.6666666666666 | 925.0 | Domain | C2 | |
Tgene | INPP4B | chr4:6826411 | chr4:142950067 | ENST00000308502 | 21 | 23 | 23_165 | 880.6666666666666 | 925.0 | Domain | C2 | |
Tgene | INPP4B | chr4:6826411 | chr4:142950067 | ENST00000508116 | 23 | 25 | 23_165 | 880.6666666666666 | 925.0 | Domain | C2 | |
Tgene | INPP4B | chr4:6826411 | chr4:142950067 | ENST00000513000 | 25 | 27 | 23_165 | 880.6666666666666 | 925.0 | Domain | C2 |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
KIAA0232 | |
INPP4B |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to KIAA0232-INPP4B |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to KIAA0232-INPP4B |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |