UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:KLK3-HSP90AB1 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: KLK3-HSP90AB1 | FusionPDB ID: 43080 | FusionGDB2.0 ID: 43080 | Hgene | Tgene | Gene symbol | KLK3 | HSP90AB1 | Gene ID | 3818 | 3326 |
Gene name | kallikrein B1 | heat shock protein 90 alpha family class B member 1 | |
Synonyms | KLK3|PKK|PKKD|PPK | D6S182|HSP84|HSP90B|HSPC2|HSPCB | |
Cytomap | 4q35.2 | 6p21.1 | |
Type of gene | protein-coding | protein-coding | |
Description | plasma kallikreinkallikrein B, plasma (Fletcher factor) 1kininogeninplasma prekallikrein | heat shock protein HSP 90-betaHSP90-betaheat shock 84 kDaheat shock 90kD protein 1, betaheat shock protein 90 kDaheat shock protein 90kDa alpha (cytosolic), class B member 1heat shock protein 90kDa alpha family class B member 1 | |
Modification date | 20200320 | 20200327 | |
UniProtAcc | P07288 | P08238 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000360617, ENST00000595952, ENST00000326003, ENST00000593997, ENST00000597483, | ENST00000353801, ENST00000371554, ENST00000371646, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 24 X 31 X 2=1488 | 17 X 17 X 9=2601 |
# samples | 31 | 20 | |
** MAII score | log2(31/1488*10)=-2.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(20/2601*10)=-3.70099449416827 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: KLK3 [Title/Abstract] AND HSP90AB1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | KLK3(51363383)-HSP90AB1(44220943), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | KLK3-HSP90AB1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. KLK3-HSP90AB1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. KLK3-HSP90AB1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. KLK3-HSP90AB1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. KLK3-HSP90AB1 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. KLK3-HSP90AB1 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. KLK3-HSP90AB1 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | KLK3 | GO:0031639 | plasminogen activation | 89876 |
Hgene | KLK3 | GO:0051919 | positive regulation of fibrinolysis | 89876 |
Tgene | HSP90AB1 | GO:0007004 | telomere maintenance via telomerase | 10197982 |
Tgene | HSP90AB1 | GO:0030511 | positive regulation of transforming growth factor beta receptor signaling pathway | 24613385 |
Tgene | HSP90AB1 | GO:0031396 | regulation of protein ubiquitination | 16809764 |
Tgene | HSP90AB1 | GO:0032435 | negative regulation of proteasomal ubiquitin-dependent protein catabolic process | 24613385 |
Tgene | HSP90AB1 | GO:0032516 | positive regulation of phosphoprotein phosphatase activity | 26593036 |
Tgene | HSP90AB1 | GO:0051131 | chaperone-mediated protein complex assembly | 10811660 |
Tgene | HSP90AB1 | GO:0051973 | positive regulation of telomerase activity | 10197982 |
Tgene | HSP90AB1 | GO:1901389 | negative regulation of transforming growth factor beta activation | 20599762 |
Tgene | HSP90AB1 | GO:1905323 | telomerase holoenzyme complex assembly | 10197982 |
Tgene | HSP90AB1 | GO:2000010 | positive regulation of protein localization to cell surface | 23431407 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | PRAD | TCGA-HC-7819 | KLK3 | chr19 | 51363383 | + | HSP90AB1 | chr6 | 44220943 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000326003 | KLK3 | chr19 | 51363383 | + | ENST00000353801 | HSP90AB1 | chr6 | 44220943 | + | 1874 | 1307 | 17 | 754 | 245 |
ENST00000326003 | KLK3 | chr19 | 51363383 | + | ENST00000371646 | HSP90AB1 | chr6 | 44220943 | + | 1874 | 1307 | 17 | 754 | 245 |
ENST00000326003 | KLK3 | chr19 | 51363383 | + | ENST00000371554 | HSP90AB1 | chr6 | 44220943 | + | 1874 | 1307 | 17 | 754 | 245 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000326003 | ENST00000353801 | KLK3 | chr19 | 51363383 | + | HSP90AB1 | chr6 | 44220943 | + | 0.08377897 | 0.916221 |
ENST00000326003 | ENST00000371646 | KLK3 | chr19 | 51363383 | + | HSP90AB1 | chr6 | 44220943 | + | 0.08377897 | 0.916221 |
ENST00000326003 | ENST00000371554 | KLK3 | chr19 | 51363383 | + | HSP90AB1 | chr6 | 44220943 | + | 0.08377897 | 0.916221 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >43080_43080_1_KLK3-HSP90AB1_KLK3_chr19_51363383_ENST00000326003_HSP90AB1_chr6_44220943_ENST00000353801_length(amino acids)=245AA_BP= MHPESCVTMWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFH PEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQ -------------------------------------------------------------- >43080_43080_2_KLK3-HSP90AB1_KLK3_chr19_51363383_ENST00000326003_HSP90AB1_chr6_44220943_ENST00000371554_length(amino acids)=245AA_BP= MHPESCVTMWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFH PEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQ -------------------------------------------------------------- >43080_43080_3_KLK3-HSP90AB1_KLK3_chr19_51363383_ENST00000326003_HSP90AB1_chr6_44220943_ENST00000371646_length(amino acids)=245AA_BP= MHPESCVTMWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFH PEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQ -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:51363383/chr6:44220943) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
KLK3 | HSP90AB1 |
FUNCTION: Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum. | FUNCTION: Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function (PubMed:16478993, PubMed:19696785). Engages with a range of client protein classes via its interaction with various co-chaperone proteins or complexes, that act as adapters, simultaneously able to interact with the specific client and the central chaperone itself. Recruitment of ATP and co-chaperone followed by client protein forms a functional chaperone. After the completion of the chaperoning process, properly folded client protein and co-chaperone leave HSP90 in an ADP-bound partially open conformation and finally, ADP is released from HSP90 which acquires an open conformation for the next cycle (PubMed:27295069, PubMed:26991466). Apart from its chaperone activity, it also plays a role in the regulation of the transcription machinery. HSP90 and its co-chaperones modulate transcription at least at three different levels. They first alter the steady-state levels of certain transcription factors in response to various physiological cues. Second, they modulate the activity of certain epigenetic modifiers, such as histone deacetylases or DNA methyl transferases, and thereby respond to the change in the environment. Third, they participate in the eviction of histones from the promoter region of certain genes and thereby turn on gene expression (PubMed:25973397). Antagonizes STUB1-mediated inhibition of TGF-beta signaling via inhibition of STUB1-mediated SMAD3 ubiquitination and degradation (PubMed:24613385). Promotes cell differentiation by chaperoning BIRC2 and thereby protecting from auto-ubiquitination and degradation by the proteasomal machinery (PubMed:18239673). Main chaperone involved in the phosphorylation/activation of the STAT1 by chaperoning both JAK2 and PRKCE under heat shock and in turn, activates its own transcription (PubMed:20353823). Involved in the translocation into ERGIC (endoplasmic reticulum-Golgi intermediate compartment) of leaderless cargos (lacking the secretion signal sequence) such as the interleukin 1/IL-1; the translocation process is mediated by the cargo receptor TMED10 (PubMed:32272059). {ECO:0000269|PubMed:16478993, ECO:0000269|PubMed:18239673, ECO:0000269|PubMed:19696785, ECO:0000269|PubMed:20353823, ECO:0000269|PubMed:24613385, ECO:0000269|PubMed:32272059, ECO:0000303|PubMed:25973397, ECO:0000303|PubMed:26991466, ECO:0000303|PubMed:27295069}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | HSP90AB1 | chr19:51363383 | chr6:44220943 | ENST00000353801 | 0 | 12 | 720_724 | 0 | 725.0 | Motif | Note=TPR repeat-binding | |
Tgene | HSP90AB1 | chr19:51363383 | chr6:44220943 | ENST00000371554 | 0 | 12 | 720_724 | 0 | 725.0 | Motif | Note=TPR repeat-binding | |
Tgene | HSP90AB1 | chr19:51363383 | chr6:44220943 | ENST00000371646 | 0 | 12 | 720_724 | 0 | 725.0 | Motif | Note=TPR repeat-binding |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | KLK3 | chr19:51363383 | chr6:44220943 | ENST00000326003 | + | 1 | 5 | 25_258 | 0 | 262.0 | Domain | Peptidase S1 |
Hgene | KLK3 | chr19:51363383 | chr6:44220943 | ENST00000360617 | + | 1 | 5 | 25_258 | 0.0 | 239.0 | Domain | Peptidase S1 |
Hgene | KLK3 | chr19:51363383 | chr6:44220943 | ENST00000593997 | + | 1 | 4 | 25_258 | 0 | 228.0 | Domain | Peptidase S1 |
Hgene | KLK3 | chr19:51363383 | chr6:44220943 | ENST00000595952 | + | 1 | 5 | 25_258 | 0 | 219.0 | Domain | Peptidase S1 |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
KLK3 | |
HSP90AB1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to KLK3-HSP90AB1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to KLK3-HSP90AB1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |