| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:LATS2-CRYL1 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: LATS2-CRYL1 | FusionPDB ID: 44208 | FusionGDB2.0 ID: 44208 | Hgene | Tgene | Gene symbol | LATS2 | CRYL1 | Gene ID | 26524 | 51084 |
| Gene name | large tumor suppressor kinase 2 | crystallin lambda 1 | |
| Synonyms | KPM | GDH|HEL30|gul3DH|lambda-CRY | |
| Cytomap | 13q12.11 | 13q12.11 | |
| Type of gene | protein-coding | protein-coding | |
| Description | serine/threonine-protein kinase LATS2LATS (large tumor suppressor, Drosophila) homolog 2LATS, large tumor suppressor, homolog 2kinase phosphorylated during mitosis proteinlarge tumor suppressor homolog 2serine/threonine kinase KPMserine/threonine-pr | lambda-crystallin homologL-gulonate 3-dehydrogenasecrystallin, lamda 1epididymis luminal protein 30testicular tissue protein Li 44 | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q9NRM7 | Q9Y2S2 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000382592, ENST00000542899, ENST00000472754, | ENST00000480748, ENST00000298248, ENST00000382812, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 4 X 6 X 3=72 | 15 X 9 X 10=1350 |
| # samples | 5 | 17 | |
| ** MAII score | log2(5/72*10)=-0.526068811667588 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(17/1350*10)=-2.98935275580049 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: LATS2 [Title/Abstract] AND CRYL1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | LATS2(21619824)-CRYL1(21063635), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | LATS2-CRYL1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. LATS2-CRYL1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. LATS2-CRYL1 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. LATS2-CRYL1 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. LATS2-CRYL1 seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. LATS2-CRYL1 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. LATS2-CRYL1 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | LATS2 | GO:0000082 | G1/S transition of mitotic cell cycle | 12853976 |
| Hgene | LATS2 | GO:0006468 | protein phosphorylation | 10871863 |
| Hgene | LATS2 | GO:0009755 | hormone-mediated signaling pathway | 15131260 |
| Hgene | LATS2 | GO:0035329 | hippo signaling | 20412773 |
| Hgene | LATS2 | GO:0035556 | intracellular signal transduction | 10871863 |
| Hgene | LATS2 | GO:0045736 | negative regulation of cyclin-dependent protein serine/threonine kinase activity | 12853976 |
| Fusion gene breakpoints across LATS2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across CRYL1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | STAD | TCGA-D7-8570-01A | LATS2 | chr13 | 21619824 | - | CRYL1 | chr13 | 21063635 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000382592 | LATS2 | chr13 | 21619824 | - | ENST00000298248 | CRYL1 | chr13 | 21063635 | - | 2021 | 748 | 755 | 1558 | 267 |
| ENST00000382592 | LATS2 | chr13 | 21619824 | - | ENST00000382812 | CRYL1 | chr13 | 21063635 | - | 2017 | 748 | 755 | 1558 | 267 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000382592 | ENST00000298248 | LATS2 | chr13 | 21619824 | - | CRYL1 | chr13 | 21063635 | - | 0.006683477 | 0.99331653 |
| ENST00000382592 | ENST00000382812 | LATS2 | chr13 | 21619824 | - | CRYL1 | chr13 | 21063635 | - | 0.00668521 | 0.9933148 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >44208_44208_1_LATS2-CRYL1_LATS2_chr13_21619824_ENST00000382592_CRYL1_chr13_21063635_ENST00000298248_length(amino acids)=267AA_BP=0 MKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQCI VAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRY -------------------------------------------------------------- >44208_44208_2_LATS2-CRYL1_LATS2_chr13_21619824_ENST00000382592_CRYL1_chr13_21063635_ENST00000382812_length(amino acids)=267AA_BP=0 MKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQCI VAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRY -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr13:21619824/chr13:21063635) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| LATS2 | CRYL1 |
| FUNCTION: Negative regulator of YAP1 in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Acts as a tumor suppressor which plays a critical role in centrosome duplication, maintenance of mitotic fidelity and genomic stability. Negatively regulates G1/S transition by down-regulating cyclin E/CDK2 kinase activity. Negative regulator of the androgen receptor. Phosphorylates SNAI1 in the nucleus leading to its nuclear retention and stabilization, which enhances its epithelial-mesenchymal transition and tumor cell invasion/migration activities. This tumor-promoting activity is independent of its effects upon YAP1 or WWTR1/TAZ. {ECO:0000269|PubMed:10871863, ECO:0000269|PubMed:12853976, ECO:0000269|PubMed:15131260, ECO:0000269|PubMed:18158288, ECO:0000269|PubMed:21952048}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | LATS2 | chr13:21619824 | chr13:21063635 | ENST00000382592 | - | 2 | 8 | 668_973 | 114.0 | 1089.0 | Domain | Protein kinase |
| Hgene | LATS2 | chr13:21619824 | chr13:21063635 | ENST00000382592 | - | 2 | 8 | 974_1052 | 114.0 | 1089.0 | Domain | AGC-kinase C-terminal |
| Hgene | LATS2 | chr13:21619824 | chr13:21063635 | ENST00000382592 | - | 2 | 8 | 98_139 | 114.0 | 1089.0 | Domain | UBA |
| Hgene | LATS2 | chr13:21619824 | chr13:21063635 | ENST00000542899 | - | 2 | 8 | 668_973 | 114.0 | 1089.0 | Domain | Protein kinase |
| Hgene | LATS2 | chr13:21619824 | chr13:21063635 | ENST00000542899 | - | 2 | 8 | 974_1052 | 114.0 | 1089.0 | Domain | AGC-kinase C-terminal |
| Hgene | LATS2 | chr13:21619824 | chr13:21063635 | ENST00000542899 | - | 2 | 8 | 98_139 | 114.0 | 1089.0 | Domain | UBA |
| Hgene | LATS2 | chr13:21619824 | chr13:21063635 | ENST00000382592 | - | 2 | 8 | 515_518 | 114.0 | 1089.0 | Motif | Note=PPxY motif |
| Hgene | LATS2 | chr13:21619824 | chr13:21063635 | ENST00000542899 | - | 2 | 8 | 515_518 | 114.0 | 1089.0 | Motif | Note=PPxY motif |
| Hgene | LATS2 | chr13:21619824 | chr13:21063635 | ENST00000382592 | - | 2 | 8 | 674_782 | 114.0 | 1089.0 | Nucleotide binding | ATP |
| Hgene | LATS2 | chr13:21619824 | chr13:21063635 | ENST00000542899 | - | 2 | 8 | 674_782 | 114.0 | 1089.0 | Nucleotide binding | ATP |
| Tgene | CRYL1 | chr13:21619824 | chr13:21063635 | ENST00000298248 | 1 | 8 | 16_17 | 49.666666666666664 | 320.0 | Nucleotide binding | NAD | |
| Tgene | CRYL1 | chr13:21619824 | chr13:21063635 | ENST00000382812 | 2 | 9 | 16_17 | 27.666666666666668 | 298.0 | Nucleotide binding | NAD |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| LATS2 | |
| CRYL1 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to LATS2-CRYL1 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to LATS2-CRYL1 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies