UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:MAEA-ATP6V0C |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: MAEA-ATP6V0C | FusionPDB ID: 50699 | FusionGDB2.0 ID: 50699 | Hgene | Tgene | Gene symbol | MAEA | ATP6V0C | Gene ID | 10296 | 527 |
Gene name | macrophage erythroblast attacher, E3 ubiquitin ligase | ATPase H+ transporting V0 subunit c | |
Synonyms | EMLP|EMP|GID9|HLC-10|P44EMLP|PIG5 | ATP6C|ATP6L|ATPL|VATL|VPPC|Vma3 | |
Cytomap | 4p16.3 | 16p13.3 | |
Type of gene | protein-coding | protein-coding | |
Description | E3 ubiquitin-protein transferase MAEAGID complex subunit 9, FYV10 homologcell proliferation-inducing gene 5 proteinerythroblast macrophage proteinhuman lung cancer oncogene 10 proteinlung cancer-related protein 10macrophage erythroblast attacher | V-type proton ATPase 16 kDa proteolipid subunitATPase, H+ transporting, lysosomal 16kDa, V0 subunit cH(+)-transporting two-sector ATPase, 16 kDa subunitV-ATPase 16 kDa proteolipid subunitvacuolar ATP synthase 16 kDa proteolipid subunitvacuolar H+ ATP | |
Modification date | 20200314 | 20200313 | |
UniProtAcc | Q7L5Y9 | P27449 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000264750, ENST00000303400, ENST00000452175, ENST00000505177, ENST00000514708, ENST00000505839, ENST00000510794, ENST00000512289, | ENST00000564973, ENST00000565223, ENST00000330398, ENST00000568562, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 7 X 7 X 5=245 | 8 X 8 X 3=192 |
# samples | 11 | 9 | |
** MAII score | log2(11/245*10)=-1.15527822547791 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/192*10)=-1.09310940439148 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: MAEA [Title/Abstract] AND ATP6V0C [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MAEA(1283770)-ATP6V0C(2569219), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | MAEA-ATP6V0C seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MAEA-ATP6V0C seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MAEA-ATP6V0C seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. MAEA-ATP6V0C seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. MAEA-ATP6V0C seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | MAEA | GO:0007155 | cell adhesion | 9763581 |
Hgene | MAEA | GO:0033033 | negative regulation of myeloid cell apoptotic process | 9763581 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | Non-Cancer | ERR315486 | MAEA | chr4 | 1283770 | + | ATP6V0C | chr16 | 2569219 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000303400 | MAEA | chr4 | 1283770 | + | ENST00000568562 | ATP6V0C | chr16 | 2569219 | + | 455 | 132 | 44 | 454 | 137 |
ENST00000505177 | MAEA | chr4 | 1283770 | + | ENST00000568562 | ATP6V0C | chr16 | 2569219 | + | 419 | 96 | 8 | 418 | 137 |
ENST00000264750 | MAEA | chr4 | 1283770 | + | ENST00000568562 | ATP6V0C | chr16 | 2569219 | + | 415 | 92 | 4 | 414 | 137 |
ENST00000452175 | MAEA | chr4 | 1283770 | + | ENST00000568562 | ATP6V0C | chr16 | 2569219 | + | 412 | 89 | 1 | 411 | 137 |
ENST00000514708 | MAEA | chr4 | 1283770 | + | ENST00000568562 | ATP6V0C | chr16 | 2569219 | + | 411 | 88 | 0 | 410 | 137 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000303400 | ENST00000568562 | MAEA | chr4 | 1283770 | + | ATP6V0C | chr16 | 2569219 | + | 0.24203755 | 0.75796247 |
ENST00000505177 | ENST00000568562 | MAEA | chr4 | 1283770 | + | ATP6V0C | chr16 | 2569219 | + | 0.25975066 | 0.7402493 |
ENST00000264750 | ENST00000568562 | MAEA | chr4 | 1283770 | + | ATP6V0C | chr16 | 2569219 | + | 0.257217 | 0.742783 |
ENST00000452175 | ENST00000568562 | MAEA | chr4 | 1283770 | + | ATP6V0C | chr16 | 2569219 | + | 0.22389223 | 0.77610785 |
ENST00000514708 | ENST00000568562 | MAEA | chr4 | 1283770 | + | ATP6V0C | chr16 | 2569219 | + | 0.22346738 | 0.77653265 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >50699_50699_1_MAEA-ATP6V0C_MAEA_chr4_1283770_ENST00000264750_ATP6V0C_chr16_2569219_ENST00000568562_length(amino acids)=137AA_BP=27 MFWPLQDGGAGVGGSVVHDPEGPGVPDPQALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLY -------------------------------------------------------------- >50699_50699_2_MAEA-ATP6V0C_MAEA_chr4_1283770_ENST00000303400_ATP6V0C_chr16_2569219_ENST00000568562_length(amino acids)=137AA_BP=27 MFWPLQDGGAGVGGSVVHDPEGPGVPDPQALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLY -------------------------------------------------------------- >50699_50699_3_MAEA-ATP6V0C_MAEA_chr4_1283770_ENST00000452175_ATP6V0C_chr16_2569219_ENST00000568562_length(amino acids)=137AA_BP=27 MFWPLQDGGAGVGGSVVHDPEGPGVPDPQALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLY -------------------------------------------------------------- >50699_50699_4_MAEA-ATP6V0C_MAEA_chr4_1283770_ENST00000505177_ATP6V0C_chr16_2569219_ENST00000568562_length(amino acids)=137AA_BP=27 MFWPLQDGGAGVGGSVVHDPEGPGVPDPQALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLY -------------------------------------------------------------- >50699_50699_5_MAEA-ATP6V0C_MAEA_chr4_1283770_ENST00000514708_ATP6V0C_chr16_2569219_ENST00000568562_length(amino acids)=137AA_BP=27 MFWPLQDGGAGVGGSVVHDPEGPGVPDPQALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLY -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr4:1283770/chr16:2569219) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
MAEA | ATP6V0C |
FUNCTION: Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1. MAEA and RMND5A are both required for catalytic activity of the CTLH E3 ubiquitin-protein ligase complex (PubMed:29911972). MAEA is required for normal cell proliferation (PubMed:29911972). The CTLH E3 ubiquitin-protein ligase complex is not required for the degradation of enzymes involved in gluconeogenesis, such as FBP1 (PubMed:29911972). Plays a role in erythroblast enucleation during erythrocyte maturation and in the development of mature macrophages (By similarity). Mediates the attachment of erythroid cell to mature macrophages; this MAEA-mediated contact inhibits erythroid cell apoptosis (PubMed:9763581). Participates in erythroblastic island formation, which is the functional unit of definitive erythropoiesis. Associates with F-actin to regulate actin distribution in erythroblasts and macrophages (By similarity). May contribute to nuclear architecture and cells division events (Probable). {ECO:0000250|UniProtKB:Q4VC33, ECO:0000269|PubMed:29911972, ECO:0000269|PubMed:9763581, ECO:0000305|PubMed:16510120}. | FUNCTION: Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | ATP6V0C | chr4:1283770 | chr16:2569219 | ENST00000330398 | 0 | 3 | 115_131 | 26.333333333333332 | 156.0 | Topological domain | Cytoplasmic | |
Tgene | ATP6V0C | chr4:1283770 | chr16:2569219 | ENST00000330398 | 0 | 3 | 153_155 | 26.333333333333332 | 156.0 | Topological domain | Lumenal | |
Tgene | ATP6V0C | chr4:1283770 | chr16:2569219 | ENST00000330398 | 0 | 3 | 34_55 | 26.333333333333332 | 156.0 | Topological domain | Cytoplasmic | |
Tgene | ATP6V0C | chr4:1283770 | chr16:2569219 | ENST00000330398 | 0 | 3 | 77_92 | 26.333333333333332 | 156.0 | Topological domain | Lumenal | |
Tgene | ATP6V0C | chr4:1283770 | chr16:2569219 | ENST00000330398 | 0 | 3 | 132_152 | 26.333333333333332 | 156.0 | Transmembrane | Helical | |
Tgene | ATP6V0C | chr4:1283770 | chr16:2569219 | ENST00000330398 | 0 | 3 | 56_76 | 26.333333333333332 | 156.0 | Transmembrane | Helical | |
Tgene | ATP6V0C | chr4:1283770 | chr16:2569219 | ENST00000330398 | 0 | 3 | 93_114 | 26.333333333333332 | 156.0 | Transmembrane | Helical |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | MAEA | chr4:1283770 | chr16:2569219 | ENST00000264750 | + | 1 | 8 | 121_153 | 23.0 | 356.0 | Domain | LisH |
Hgene | MAEA | chr4:1283770 | chr16:2569219 | ENST00000264750 | + | 1 | 8 | 159_216 | 23.0 | 356.0 | Domain | CTLH |
Hgene | MAEA | chr4:1283770 | chr16:2569219 | ENST00000303400 | + | 1 | 9 | 121_153 | 23.0 | 397.0 | Domain | LisH |
Hgene | MAEA | chr4:1283770 | chr16:2569219 | ENST00000303400 | + | 1 | 9 | 159_216 | 23.0 | 397.0 | Domain | CTLH |
Hgene | MAEA | chr4:1283770 | chr16:2569219 | ENST00000264750 | + | 1 | 8 | 1_124 | 23.0 | 356.0 | Region | Extracellular and involved in cell to cell contact |
Hgene | MAEA | chr4:1283770 | chr16:2569219 | ENST00000303400 | + | 1 | 9 | 1_124 | 23.0 | 397.0 | Region | Extracellular and involved in cell to cell contact |
Hgene | MAEA | chr4:1283770 | chr16:2569219 | ENST00000264750 | + | 1 | 8 | 314_381 | 23.0 | 356.0 | Zinc finger | RING-Gid-type |
Hgene | MAEA | chr4:1283770 | chr16:2569219 | ENST00000303400 | + | 1 | 9 | 314_381 | 23.0 | 397.0 | Zinc finger | RING-Gid-type |
Tgene | ATP6V0C | chr4:1283770 | chr16:2569219 | ENST00000330398 | 0 | 3 | 1_10 | 26.333333333333332 | 156.0 | Topological domain | Lumenal | |
Tgene | ATP6V0C | chr4:1283770 | chr16:2569219 | ENST00000330398 | 0 | 3 | 11_33 | 26.333333333333332 | 156.0 | Transmembrane | Helical |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
MAEA | |
ATP6V0C |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to MAEA-ATP6V0C |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to MAEA-ATP6V0C |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |