| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:MALT1-NOL4 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: MALT1-NOL4 | FusionPDB ID: 50982 | FusionGDB2.0 ID: 50982 | Hgene | Tgene | Gene symbol | MALT1 | NOL4 | Gene ID | 10892 | 8715 |
| Gene name | MALT1 paracaspase | nucleolar protein 4 | |
| Synonyms | IMD12|MLT|MLT1|PCASP1 | CT125|HRIHFB2255|NOLP | |
| Cytomap | 18q21.32 | 18q12.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | mucosa-associated lymphoid tissue lymphoma translocation protein 1MALT1 proteasecaspase-like proteinmucosa associated lymphoid tissue lymphoma translocation gene 1paracaspase-1 | nucleolar protein 4cancer/testis antigen 125nucleolar localized protein | |
| Modification date | 20200315 | 20200313 | |
| UniProtAcc | Q9UDY8 | Q96MY1 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000345724, ENST00000348428, | ENST00000590846, ENST00000261592, ENST00000269185, ENST00000535384, ENST00000535475, ENST00000589544, ENST00000538587, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 5 X 4 X 5=100 | 9 X 10 X 5=450 |
| # samples | 5 | 9 | |
| ** MAII score | log2(5/100*10)=-1 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/450*10)=-2.32192809488736 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: MALT1 [Title/Abstract] AND NOL4 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MALT1(56367823)-NOL4(31432999), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | MALT1-NOL4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MALT1-NOL4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MALT1-NOL4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MALT1-NOL4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MALT1-NOL4 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. MALT1-NOL4 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. MALT1-NOL4 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. MALT1-NOL4 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | MALT1 | GO:0006508 | proteolysis | 18223652 |
| Hgene | MALT1 | GO:0042981 | regulation of apoptotic process | 12819136 |
| Hgene | MALT1 | GO:0050852 | T cell receptor signaling pathway | 15125833 |
| Hgene | MALT1 | GO:0051168 | nuclear export | 16123224 |
| Fusion gene breakpoints across MALT1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across NOL4 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | LUSC | TCGA-77-8131-01A | MALT1 | chr18 | 56367823 | - | NOL4 | chr18 | 31432999 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000348428 | MALT1 | chr18 | 56367823 | - | ENST00000538587 | NOL4 | chr18 | 31432999 | - | 1354 | 907 | 135 | 1100 | 321 |
| ENST00000345724 | MALT1 | chr18 | 56367823 | - | ENST00000538587 | NOL4 | chr18 | 31432999 | - | 1208 | 761 | 112 | 954 | 280 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000348428 | ENST00000538587 | MALT1 | chr18 | 56367823 | - | NOL4 | chr18 | 31432999 | - | 0.03476073 | 0.9652393 |
| ENST00000345724 | ENST00000538587 | MALT1 | chr18 | 56367823 | - | NOL4 | chr18 | 31432999 | - | 0.021624114 | 0.9783759 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >50982_50982_1_MALT1-NOL4_MALT1_chr18_56367823_ENST00000345724_NOL4_chr18_31432999_ENST00000538587_length(amino acids)=280AA_BP=217 MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLEQCSLKVLEPEGSPSL CLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAV HVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGYRESAAFLLRSAD -------------------------------------------------------------- >50982_50982_2_MALT1-NOL4_MALT1_chr18_56367823_ENST00000348428_NOL4_chr18_31432999_ENST00000538587_length(amino acids)=321AA_BP=258 MPDLFFRPCLRGSEASGRCPGAEARDGAGGSPGSPGSPARAMSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAP EGRGWRRLAELAGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVL AGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRPTDLSMKRQLAT -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr18:56367823/chr18:31432999) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| MALT1 | NOL4 |
| FUNCTION: Protease that enhances BCL10-induced activation: acts via formation of CBM complexes that channel adaptive and innate immune signaling downstream of CARD domain-containing proteins (CARD9, CARD11 and CARD14) to activate NF-kappa-B and MAP kinase p38 pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines (PubMed:11262391, PubMed:18264101, PubMed:24074955). Mediates BCL10 cleavage: MALT1-dependent BCL10 cleavage plays an important role in T-cell antigen receptor-induced integrin adhesion (PubMed:11262391, PubMed:18264101). Involved in the induction of T helper 17 cells (Th17) differentiation (PubMed:11262391, PubMed:18264101). Cleaves RC3H1 and ZC3H12A in response to T-cell receptor (TCR) stimulation which releases their cooperatively repressed targets to promote Th17 cell differentiation (By similarity). Also mediates cleavage of N4BP1 in T-cells following TCR-mediated activation, leading to N4BP1 inactivation (PubMed:31133753). May also have ubiquitin ligase activity: binds to TRAF6, inducing TRAF6 oligomerization and activation of its ligase activity (PubMed:14695475). {ECO:0000250|UniProtKB:Q2TBA3, ECO:0000269|PubMed:11262391, ECO:0000269|PubMed:14695475, ECO:0000269|PubMed:18264101, ECO:0000269|PubMed:24074955, ECO:0000269|PubMed:31133753}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MALT1 | chr18:56367823 | chr18:31432999 | ENST00000345724 | - | 4 | 16 | 125_201 | 216.33333333333334 | 814.0 | Domain | Note=Ig-like C2-type 1 |
| Hgene | MALT1 | chr18:56367823 | chr18:31432999 | ENST00000345724 | - | 4 | 16 | 39_126 | 216.33333333333334 | 814.0 | Domain | Note=Death |
| Hgene | MALT1 | chr18:56367823 | chr18:31432999 | ENST00000348428 | - | 4 | 17 | 125_201 | 216.33333333333334 | 825.0 | Domain | Note=Ig-like C2-type 1 |
| Hgene | MALT1 | chr18:56367823 | chr18:31432999 | ENST00000348428 | - | 4 | 17 | 39_126 | 216.33333333333334 | 825.0 | Domain | Note=Death |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MALT1 | chr18:56367823 | chr18:31432999 | ENST00000345724 | - | 4 | 16 | 212_305 | 216.33333333333334 | 814.0 | Domain | Note=Ig-like C2-type 2 |
| Hgene | MALT1 | chr18:56367823 | chr18:31432999 | ENST00000348428 | - | 4 | 17 | 212_305 | 216.33333333333334 | 825.0 | Domain | Note=Ig-like C2-type 2 |
| Hgene | MALT1 | chr18:56367823 | chr18:31432999 | ENST00000345724 | - | 4 | 16 | 369_376 | 216.33333333333334 | 814.0 | Motif | Note=Nuclear export signal |
| Hgene | MALT1 | chr18:56367823 | chr18:31432999 | ENST00000348428 | - | 4 | 17 | 369_376 | 216.33333333333334 | 825.0 | Motif | Note=Nuclear export signal |
| Hgene | MALT1 | chr18:56367823 | chr18:31432999 | ENST00000345724 | - | 4 | 16 | 348_562 | 216.33333333333334 | 814.0 | Region | Note=Caspase-like |
| Hgene | MALT1 | chr18:56367823 | chr18:31432999 | ENST00000348428 | - | 4 | 17 | 348_562 | 216.33333333333334 | 825.0 | Region | Note=Caspase-like |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| MALT1 |  |
| NOL4 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to MALT1-NOL4 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to MALT1-NOL4 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | MALT1 | C3809583 | IMMUNODEFICIENCY 12 | 3 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
| Hgene | MALT1 | C0079744 | Diffuse Large B-Cell Lymphoma | 1 | CTD_human |
| Hgene | MALT1 | C0494261 | Combined immunodeficiency | 1 | GENOMICS_ENGLAND |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies