| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:MAPK9-DGKB |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: MAPK9-DGKB | FusionPDB ID: 51579 | FusionGDB2.0 ID: 51579 | Hgene | Tgene | Gene symbol | MAPK9 | DGKB | Gene ID | 5601 | 1607 |
| Gene name | mitogen-activated protein kinase 9 | diacylglycerol kinase beta | |
| Synonyms | JNK-55|JNK2|JNK2A|JNK2ALPHA|JNK2B|JNK2BETA|PRKM9|SAPK|SAPK1a|p54a|p54aSAPK | DAGK2|DGK|DGK-BETA | |
| Cytomap | 5q35.3 | 7p21.2 | |
| Type of gene | protein-coding | protein-coding | |
| Description | mitogen-activated protein kinase 9Jun kinaseMAP kinase 9MAPK 9c-Jun N-terminal kinase 2c-Jun kinase 2stress-activated protein kinase 1astress-activated protein kinase JNK2 | diacylglycerol kinase beta90 kDa diacylglycerol kinaseDAG kinase betadiacylglycerol kinase, beta 90kDadiglyceride kinase beta | |
| Modification date | 20200327 | 20200313 | |
| UniProtAcc | P45984 | Q9Y6T7 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000397072, ENST00000343111, ENST00000347470, ENST00000393360, ENST00000425491, ENST00000452135, ENST00000455781, ENST00000539014, ENST00000524170, | ENST00000258767, ENST00000399322, ENST00000402815, ENST00000403951, ENST00000406247, ENST00000407950, ENST00000444700, ENST00000403963, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 9 X 10 X 6=540 | 19 X 16 X 9=2736 |
| # samples | 10 | 19 | |
| ** MAII score | log2(10/540*10)=-2.43295940727611 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(19/2736*10)=-3.84799690655495 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: MAPK9 [Title/Abstract] AND DGKB [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MAPK9(179691781)-DGKB(14661119), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | MAPK9-DGKB seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MAPK9-DGKB seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MAPK9-DGKB seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MAPK9-DGKB seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MAPK9-DGKB seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. MAPK9-DGKB seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. MAPK9-DGKB seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. MAPK9-DGKB seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | MAPK9 | GO:0007254 | JNK cascade | 8654373 |
| Hgene | MAPK9 | GO:0018105 | peptidyl-serine phosphorylation | 21856198 |
| Tgene | DGKB | GO:0046486 | glycerolipid metabolic process | 22627129 |
| Tgene | DGKB | GO:0046834 | lipid phosphorylation | 22627129 |
| Fusion gene breakpoints across MAPK9 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across DGKB (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | PRAD | TCGA-EJ-7789-01A | MAPK9 | chr5 | 179691781 | - | DGKB | chr7 | 14661119 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000539014 | MAPK9 | chr5 | 179691781 | - | ENST00000399322 | DGKB | chr7 | 14661119 | - | 5658 | 331 | 403 | 1575 | 390 |
| ENST00000539014 | MAPK9 | chr5 | 179691781 | - | ENST00000258767 | DGKB | chr7 | 14661119 | - | 5658 | 331 | 403 | 1575 | 390 |
| ENST00000539014 | MAPK9 | chr5 | 179691781 | - | ENST00000403951 | DGKB | chr7 | 14661119 | - | 5658 | 331 | 403 | 1575 | 390 |
| ENST00000539014 | MAPK9 | chr5 | 179691781 | - | ENST00000402815 | DGKB | chr7 | 14661119 | - | 4473 | 331 | 403 | 1575 | 390 |
| ENST00000539014 | MAPK9 | chr5 | 179691781 | - | ENST00000407950 | DGKB | chr7 | 14661119 | - | 2398 | 331 | 403 | 1575 | 390 |
| ENST00000539014 | MAPK9 | chr5 | 179691781 | - | ENST00000444700 | DGKB | chr7 | 14661119 | - | 2115 | 331 | 403 | 1575 | 390 |
| ENST00000539014 | MAPK9 | chr5 | 179691781 | - | ENST00000406247 | DGKB | chr7 | 14661119 | - | 2334 | 331 | 403 | 1482 | 359 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000539014 | ENST00000399322 | MAPK9 | chr5 | 179691781 | - | DGKB | chr7 | 14661119 | - | 0.000214189 | 0.99978584 |
| ENST00000539014 | ENST00000258767 | MAPK9 | chr5 | 179691781 | - | DGKB | chr7 | 14661119 | - | 0.000214189 | 0.99978584 |
| ENST00000539014 | ENST00000403951 | MAPK9 | chr5 | 179691781 | - | DGKB | chr7 | 14661119 | - | 0.000214189 | 0.99978584 |
| ENST00000539014 | ENST00000402815 | MAPK9 | chr5 | 179691781 | - | DGKB | chr7 | 14661119 | - | 0.000252901 | 0.9997471 |
| ENST00000539014 | ENST00000407950 | MAPK9 | chr5 | 179691781 | - | DGKB | chr7 | 14661119 | - | 0.000442892 | 0.9995571 |
| ENST00000539014 | ENST00000444700 | MAPK9 | chr5 | 179691781 | - | DGKB | chr7 | 14661119 | - | 0.000604281 | 0.9993957 |
| ENST00000539014 | ENST00000406247 | MAPK9 | chr5 | 179691781 | - | DGKB | chr7 | 14661119 | - | 0.000305666 | 0.99969435 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >51579_51579_1_MAPK9-DGKB_MAPK9_chr5_179691781_ENST00000539014_DGKB_chr7_14661119_ENST00000258767_length(amino acids)=390AA_BP= MQRANSVTVDGQGLQVTPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWVL DCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYEGENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDAS IAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHR RIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKITH -------------------------------------------------------------- >51579_51579_2_MAPK9-DGKB_MAPK9_chr5_179691781_ENST00000539014_DGKB_chr7_14661119_ENST00000399322_length(amino acids)=390AA_BP= MQRANSVTVDGQGLQVTPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWVL DCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYEGENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDAS IAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHR RIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKITH -------------------------------------------------------------- >51579_51579_3_MAPK9-DGKB_MAPK9_chr5_179691781_ENST00000539014_DGKB_chr7_14661119_ENST00000402815_length(amino acids)=390AA_BP= MQRANSVTVDGQGLQVTPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWVL DCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYEGENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDAS IAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHR RIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKITH -------------------------------------------------------------- >51579_51579_4_MAPK9-DGKB_MAPK9_chr5_179691781_ENST00000539014_DGKB_chr7_14661119_ENST00000403951_length(amino acids)=390AA_BP= MQRANSVTVDGQGLQVTPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWVL DCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYEGENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDAS IAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHR RIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKITH -------------------------------------------------------------- >51579_51579_5_MAPK9-DGKB_MAPK9_chr5_179691781_ENST00000539014_DGKB_chr7_14661119_ENST00000406247_length(amino acids)=359AA_BP= MQRANSVTVDGQGLQVTPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWVL DCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYEGENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDAS IAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHR -------------------------------------------------------------- >51579_51579_6_MAPK9-DGKB_MAPK9_chr5_179691781_ENST00000539014_DGKB_chr7_14661119_ENST00000407950_length(amino acids)=390AA_BP= MQRANSVTVDGQGLQVTPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWVL DCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYEGENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDAS IAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHR RIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKITH -------------------------------------------------------------- >51579_51579_7_MAPK9-DGKB_MAPK9_chr5_179691781_ENST00000539014_DGKB_chr7_14661119_ENST00000444700_length(amino acids)=390AA_BP= MQRANSVTVDGQGLQVTPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLNFFRDVPDFRVLACGGDGTVGWVL DCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYEGENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDAS IAHRFHIMREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHR RIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKITH -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr5:179691781/chr7:14661119) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| MAPK9 | DGKB |
| FUNCTION: Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death. Extracellular stimuli such as proinflammatory cytokines or physical stress stimulate the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK9/JNK2. In turn, MAPK9/JNK2 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN and ATF2 and thus regulates AP-1 transcriptional activity. In response to oxidative or ribotoxic stresses, inhibits rRNA synthesis by phosphorylating and inactivating the RNA polymerase 1-specific transcription initiation factor RRN3. Promotes stressed cell apoptosis by phosphorylating key regulatory factors including TP53 and YAP1. In T-cells, MAPK8 and MAPK9 are required for polarized differentiation of T-helper cells into Th1 cells. Upon T-cell receptor (TCR) stimulation, is activated by CARMA1, BCL10, MAP2K7 and MAP3K7/TAK1 to regulate JUN protein levels. Plays an important role in the osmotic stress-induced epithelial tight-junctions disruption. When activated, promotes beta-catenin/CTNNB1 degradation and inhibits the canonical Wnt signaling pathway. Participates also in neurite growth in spiral ganglion neurons. Phosphorylates the CLOCK-ARNTL/BMAL1 heterodimer and plays a role in the regulation of the circadian clock (PubMed:22441692). Phosphorylates POU5F1, which results in the inhibition of POU5F1's transcriptional activity and enhances its proteosomal degradation (By similarity). {ECO:0000250|UniProtKB:Q9WTU6, ECO:0000269|PubMed:22441692}.; FUNCTION: MAPK9 isoforms display different binding patterns: alpha-1 and alpha-2 preferentially bind to JUN, whereas beta-1 and beta-2 bind to ATF2. However, there is no correlation between binding and phosphorylation, which is achieved at about the same efficiency by all isoforms. JUNB is not a substrate for JNK2 alpha-2, and JUND binds only weakly to it. | FUNCTION: Diacylglycerol kinase that converts diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and regulates the respective levels of these two bioactive lipids (PubMed:11719522). Thereby, acts as a central switch between the signaling pathways activated by these second messengers with different cellular targets and opposite effects in numerous biological processes (Probable). Has a higher activity with long-chain diacylglycerols like 1,2-di-(9Z-octadecenoyl)-sn-glycerol compared to 1,2-didecanoyl-sn-glycerol (By similarity). Specifically expressed in brain, it regulates neuron-specific morphological changes including neurite branching and neurite spine formation (By similarity). {ECO:0000250|UniProtKB:P49621, ECO:0000250|UniProtKB:Q6NS52, ECO:0000269|PubMed:11719522, ECO:0000305}.; FUNCTION: [Isoform 2]: Does not associate with membranes but has a diacylglycerol kinase activity. {ECO:0000269|PubMed:11719522}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000343111 | - | 4 | 12 | 32_40 | 103.66666666666667 | 383.0 | Nucleotide binding | ATP |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000393360 | - | 4 | 12 | 32_40 | 103.66666666666667 | 383.0 | Nucleotide binding | ATP |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000425491 | - | 4 | 7 | 32_40 | 103.66666666666667 | 243.0 | Nucleotide binding | ATP |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000452135 | - | 4 | 12 | 32_40 | 103.66666666666667 | 425.0 | Nucleotide binding | ATP |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000455781 | - | 4 | 12 | 32_40 | 103.66666666666667 | 425.0 | Nucleotide binding | ATP |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000399322 | 12 | 25 | 434_568 | 390.0 | 805.0 | Domain | DAGKc | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000403951 | 13 | 26 | 434_568 | 390.0 | 805.0 | Domain | DAGKc | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000406247 | 12 | 24 | 434_568 | 390.0 | 774.0 | Domain | DAGKc | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000399322 | 12 | 25 | 771_804 | 390.0 | 805.0 | Region | Required for association with membranes and function in neurite spine formation | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000403951 | 13 | 26 | 771_804 | 390.0 | 805.0 | Region | Required for association with membranes and function in neurite spine formation | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000406247 | 12 | 24 | 771_804 | 390.0 | 774.0 | Region | Required for association with membranes and function in neurite spine formation |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000343111 | - | 4 | 12 | 26_321 | 103.66666666666667 | 383.0 | Domain | Protein kinase |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000393360 | - | 4 | 12 | 26_321 | 103.66666666666667 | 383.0 | Domain | Protein kinase |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000425491 | - | 4 | 7 | 26_321 | 103.66666666666667 | 243.0 | Domain | Protein kinase |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000452135 | - | 4 | 12 | 26_321 | 103.66666666666667 | 425.0 | Domain | Protein kinase |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000455781 | - | 4 | 12 | 26_321 | 103.66666666666667 | 425.0 | Domain | Protein kinase |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000343111 | - | 4 | 12 | 183_185 | 103.66666666666667 | 383.0 | Motif | Note=TXY |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000393360 | - | 4 | 12 | 183_185 | 103.66666666666667 | 383.0 | Motif | Note=TXY |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000425491 | - | 4 | 7 | 183_185 | 103.66666666666667 | 243.0 | Motif | Note=TXY |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000452135 | - | 4 | 12 | 183_185 | 103.66666666666667 | 425.0 | Motif | Note=TXY |
| Hgene | MAPK9 | chr5:179691781 | chr7:14661119 | ENST00000455781 | - | 4 | 12 | 183_185 | 103.66666666666667 | 425.0 | Motif | Note=TXY |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000399322 | 12 | 25 | 162_173 | 390.0 | 805.0 | Calcium binding | 1 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000399322 | 12 | 25 | 207_218 | 390.0 | 805.0 | Calcium binding | 2 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000403951 | 13 | 26 | 162_173 | 390.0 | 805.0 | Calcium binding | 1 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000403951 | 13 | 26 | 207_218 | 390.0 | 805.0 | Calcium binding | 2 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000406247 | 12 | 24 | 162_173 | 390.0 | 774.0 | Calcium binding | 1 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000406247 | 12 | 24 | 207_218 | 390.0 | 774.0 | Calcium binding | 2 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000399322 | 12 | 25 | 149_184 | 390.0 | 805.0 | Domain | EF-hand 1 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000399322 | 12 | 25 | 194_229 | 390.0 | 805.0 | Domain | EF-hand 2 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000403951 | 13 | 26 | 149_184 | 390.0 | 805.0 | Domain | EF-hand 1 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000403951 | 13 | 26 | 194_229 | 390.0 | 805.0 | Domain | EF-hand 2 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000406247 | 12 | 24 | 149_184 | 390.0 | 774.0 | Domain | EF-hand 1 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000406247 | 12 | 24 | 194_229 | 390.0 | 774.0 | Domain | EF-hand 2 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000399322 | 12 | 25 | 244_294 | 390.0 | 805.0 | Zinc finger | Phorbol-ester/DAG-type 1 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000399322 | 12 | 25 | 309_358 | 390.0 | 805.0 | Zinc finger | Phorbol-ester/DAG-type 2 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000403951 | 13 | 26 | 244_294 | 390.0 | 805.0 | Zinc finger | Phorbol-ester/DAG-type 1 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000403951 | 13 | 26 | 309_358 | 390.0 | 805.0 | Zinc finger | Phorbol-ester/DAG-type 2 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000406247 | 12 | 24 | 244_294 | 390.0 | 774.0 | Zinc finger | Phorbol-ester/DAG-type 1 | |
| Tgene | DGKB | chr5:179691781 | chr7:14661119 | ENST00000406247 | 12 | 24 | 309_358 | 390.0 | 774.0 | Zinc finger | Phorbol-ester/DAG-type 2 |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| MAPK9 | |
| DGKB |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to MAPK9-DGKB |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to MAPK9-DGKB |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies