UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:MICALL2-PPP1R1B |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: MICALL2-PPP1R1B | FusionPDB ID: 53550 | FusionGDB2.0 ID: 53550 | Hgene | Tgene | Gene symbol | MICALL2 | PPP1R1B | Gene ID | 79778 | 84152 |
Gene name | MICAL like 2 | protein phosphatase 1 regulatory inhibitor subunit 1B | |
Synonyms | JRAB|MICAL-L2 | DARPP-32|DARPP32 | |
Cytomap | 7p22.3 | 17q12 | |
Type of gene | protein-coding | protein-coding | |
Description | MICAL-like protein 2junctional Rab13-binding proteinmolecule interacting with CasL-like 2 | protein phosphatase 1 regulatory subunit 1Bdopamine and cAMP-regulated neuronal phosphoprotein 32 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q8IY33 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000297508, ENST00000405088, ENST00000471899, | ENST00000394265, ENST00000394267, ENST00000254079, ENST00000579000, ENST00000580825, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 12 X 8 X 8=768 | 17 X 10 X 9=1530 |
# samples | 16 | 26 | |
** MAII score | log2(16/768*10)=-2.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(26/1530*10)=-2.55694812455156 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: MICALL2 [Title/Abstract] AND PPP1R1B [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MICALL2(1489876)-PPP1R1B(37785423), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | MICALL2-PPP1R1B seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MICALL2-PPP1R1B seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MICALL2-PPP1R1B seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MICALL2-PPP1R1B seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | PPP1R1B | GO:0032515 | negative regulation of phosphoprotein phosphatase activity | 10807923 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-BR-8080-01A | MICALL2 | chr7 | 1489876 | - | PPP1R1B | chr17 | 37785423 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000297508 | MICALL2 | chr7 | 1489876 | - | ENST00000580825 | PPP1R1B | chr17 | 37785423 | + | 1037 | 368 | 92 | 901 | 269 |
ENST00000297508 | MICALL2 | chr7 | 1489876 | - | ENST00000254079 | PPP1R1B | chr17 | 37785423 | + | 1663 | 368 | 92 | 901 | 269 |
ENST00000297508 | MICALL2 | chr7 | 1489876 | - | ENST00000579000 | PPP1R1B | chr17 | 37785423 | + | 1560 | 368 | 92 | 802 | 236 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000297508 | ENST00000580825 | MICALL2 | chr7 | 1489876 | - | PPP1R1B | chr17 | 37785423 | + | 0.011630412 | 0.9883696 |
ENST00000297508 | ENST00000254079 | MICALL2 | chr7 | 1489876 | - | PPP1R1B | chr17 | 37785423 | + | 0.007534726 | 0.99246526 |
ENST00000297508 | ENST00000579000 | MICALL2 | chr7 | 1489876 | - | PPP1R1B | chr17 | 37785423 | + | 0.004552516 | 0.99544746 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >53550_53550_1_MICALL2-PPP1R1B_MICALL2_chr7_1489876_ENST00000297508_PPP1R1B_chr17_37785423_ENST00000254079_length(amino acids)=269AA_BP=92 MSRRPGGRGTAAGRCRRAVPPRGGRAAHMAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYENN KLIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELG -------------------------------------------------------------- >53550_53550_2_MICALL2-PPP1R1B_MICALL2_chr7_1489876_ENST00000297508_PPP1R1B_chr17_37785423_ENST00000579000_length(amino acids)=236AA_BP=92 MSRRPGGRGTAAGRCRRAVPPRGGRAAHMAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYENN KLIRRRRPTPAMLFRLSEHSSPAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQS -------------------------------------------------------------- >53550_53550_3_MICALL2-PPP1R1B_MICALL2_chr7_1489876_ENST00000297508_PPP1R1B_chr17_37785423_ENST00000580825_length(amino acids)=269AA_BP=92 MSRRPGGRGTAAGRCRRAVPPRGGRAAHMAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYENN KLIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELG -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:1489876/chr17:37785423) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
MICALL2 | . |
FUNCTION: Effector of small Rab GTPases which is involved in junctional complexes assembly through the regulation of cell adhesion molecules transport to the plasma membrane and actin cytoskeleton reorganization. Regulates the endocytic recycling of occludins, claudins and E-cadherin to the plasma membrane and may thereby regulate the establishment of tight junctions and adherens junctions. In parallel, may regulate actin cytoskeleton reorganization directly through interaction with F-actin or indirectly through actinins and filamins. Most probably involved in the processes of epithelial cell differentiation, cell spreading and neurite outgrowth (By similarity). {ECO:0000250}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | PPP1R1B | chr7:1489876 | chr17:37785423 | ENST00000254079 | 0 | 7 | 119_136 | 27.0 | 205.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | PPP1R1B | chr7:1489876 | chr17:37785423 | ENST00000394265 | 0 | 7 | 119_136 | 0 | 169.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | PPP1R1B | chr7:1489876 | chr17:37785423 | ENST00000394267 | 0 | 7 | 119_136 | 0 | 169.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | PPP1R1B | chr7:1489876 | chr17:37785423 | ENST00000580825 | 1 | 8 | 119_136 | 27.0 | 205.0 | Compositional bias | Note=Asp/Glu-rich (acidic) |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000297508 | - | 2 | 17 | 735_771 | 64.0 | 905.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000405088 | - | 1 | 13 | 735_771 | 0.0 | 693.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000297508 | - | 2 | 17 | 356_359 | 64.0 | 905.0 | Compositional bias | Note=Poly-Ala |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000297508 | - | 2 | 17 | 392_397 | 64.0 | 905.0 | Compositional bias | Note=Poly-Ser |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000297508 | - | 2 | 17 | 663_666 | 64.0 | 905.0 | Compositional bias | Note=Poly-Arg |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000405088 | - | 1 | 13 | 356_359 | 0.0 | 693.0 | Compositional bias | Note=Poly-Ala |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000405088 | - | 1 | 13 | 392_397 | 0.0 | 693.0 | Compositional bias | Note=Poly-Ser |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000405088 | - | 1 | 13 | 663_666 | 0.0 | 693.0 | Compositional bias | Note=Poly-Arg |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000297508 | - | 2 | 17 | 186_248 | 64.0 | 905.0 | Domain | LIM zinc-binding |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000297508 | - | 2 | 17 | 1_107 | 64.0 | 905.0 | Domain | Calponin-homology (CH) |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000297508 | - | 2 | 17 | 723_874 | 64.0 | 905.0 | Domain | bMERB |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000405088 | - | 1 | 13 | 186_248 | 0.0 | 693.0 | Domain | LIM zinc-binding |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000405088 | - | 1 | 13 | 1_107 | 0.0 | 693.0 | Domain | Calponin-homology (CH) |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000405088 | - | 1 | 13 | 723_874 | 0.0 | 693.0 | Domain | bMERB |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000297508 | - | 2 | 17 | 261_697 | 64.0 | 905.0 | Region | Mediates targeting to the cell plasma membrane |
Hgene | MICALL2 | chr7:1489876 | chr17:37785423 | ENST00000405088 | - | 1 | 13 | 261_697 | 0.0 | 693.0 | Region | Mediates targeting to the cell plasma membrane |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
MICALL2 | |
PPP1R1B |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to MICALL2-PPP1R1B |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to MICALL2-PPP1R1B |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |