UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:MTSS1-ZC2HC1A |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: MTSS1-ZC2HC1A | FusionPDB ID: 55928 | FusionGDB2.0 ID: 55928 | Hgene | Tgene | Gene symbol | MTSS1 | ZC2HC1A | Gene ID | 9788 | 51101 |
Gene name | MTSS I-BAR domain containing 1 | zinc finger C2HC-type containing 1A | |
Synonyms | MIM|MIMA|MIMB | C8orf70|CGI-62|FAM164A | |
Cytomap | 8q24.13 | 8q21.13 | |
Type of gene | protein-coding | protein-coding | |
Description | protein MTSS 1MTSS1, I-BAR domain containingmetastasis suppressor 1metastasis suppressor YGL-1metastasis suppressor protein 1missing in metastasis protein | zinc finger C2HC domain-containing protein 1Afamily with sequence similarity 164, member Aprotein FAM164A | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | O43312 | Q96GY0 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000325064, ENST00000354184, ENST00000378017, ENST00000395508, ENST00000431961, ENST00000518547, ENST00000524090, ENST00000523587, | ENST00000521176, ENST00000263849, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 12 X 13 X 9=1404 | 5 X 6 X 4=120 |
# samples | 17 | 7 | |
** MAII score | log2(17/1404*10)=-3.04593628416686 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(7/120*10)=-0.777607578663552 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: MTSS1 [Title/Abstract] AND ZC2HC1A [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MTSS1(125575023)-ZC2HC1A(79588022), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | MTSS1-ZC2HC1A seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MTSS1-ZC2HC1A seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MTSS1-ZC2HC1A seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MTSS1-ZC2HC1A seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MTSS1-ZC2HC1A seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. MTSS1-ZC2HC1A seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-AR-A0TV-01A | MTSS1 | chr8 | 125575023 | - | ZC2HC1A | chr8 | 79588022 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000431961 | MTSS1 | chr8 | 125575023 | - | ENST00000263849 | ZC2HC1A | chr8 | 79588022 | + | 3854 | 620 | 649 | 1581 | 310 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000431961 | ENST00000263849 | MTSS1 | chr8 | 125575023 | - | ZC2HC1A | chr8 | 79588022 | + | 0.012568411 | 0.98743165 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >55928_55928_1_MTSS1-ZC2HC1A_MTSS1_chr8_125575023_ENST00000431961_ZC2HC1A_chr8_79588022_ENST00000263849_length(amino acids)=310AA_BP= MLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGG KLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSG AGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNI -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr8:125575023/chr8:79588022) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
MTSS1 | ZC2HC1A |
FUNCTION: May be related to cancer progression or tumor metastasis in a variety of organ sites, most likely through an interaction with the actin cytoskeleton. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000378017 | - | 10 | 14 | 108_155 | 345.0 | 731.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000518547 | - | 10 | 14 | 108_155 | 345.0 | 756.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000378017 | - | 10 | 14 | 1_250 | 345.0 | 731.0 | Domain | IMD |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000518547 | - | 10 | 14 | 1_250 | 345.0 | 756.0 | Domain | IMD |
Tgene | ZC2HC1A | chr8:125575023 | chr8:79588022 | ENST00000263849 | 0 | 9 | 15_39 | 5.333333333333333 | 326.0 | Zinc finger | Note=C2HC-type |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000354184 | - | 10 | 13 | 108_155 | 145.0 | 474.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000431961 | - | 5 | 8 | 108_155 | 145.0 | 474.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000354184 | - | 10 | 13 | 238_359 | 145.0 | 474.0 | Compositional bias | Note=Ser-rich |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000354184 | - | 10 | 13 | 608_726 | 145.0 | 474.0 | Compositional bias | Note=Pro-rich |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000378017 | - | 10 | 14 | 238_359 | 345.0 | 731.0 | Compositional bias | Note=Ser-rich |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000378017 | - | 10 | 14 | 608_726 | 345.0 | 731.0 | Compositional bias | Note=Pro-rich |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000431961 | - | 5 | 8 | 238_359 | 145.0 | 474.0 | Compositional bias | Note=Ser-rich |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000431961 | - | 5 | 8 | 608_726 | 145.0 | 474.0 | Compositional bias | Note=Pro-rich |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000518547 | - | 10 | 14 | 238_359 | 345.0 | 756.0 | Compositional bias | Note=Ser-rich |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000518547 | - | 10 | 14 | 608_726 | 345.0 | 756.0 | Compositional bias | Note=Pro-rich |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000354184 | - | 10 | 13 | 1_250 | 145.0 | 474.0 | Domain | IMD |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000354184 | - | 10 | 13 | 727_744 | 145.0 | 474.0 | Domain | WH2 |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000378017 | - | 10 | 14 | 727_744 | 345.0 | 731.0 | Domain | WH2 |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000431961 | - | 5 | 8 | 1_250 | 145.0 | 474.0 | Domain | IMD |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000431961 | - | 5 | 8 | 727_744 | 145.0 | 474.0 | Domain | WH2 |
Hgene | MTSS1 | chr8:125575023 | chr8:79588022 | ENST00000518547 | - | 10 | 14 | 727_744 | 345.0 | 756.0 | Domain | WH2 |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
MTSS1 | |
ZC2HC1A |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to MTSS1-ZC2HC1A |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to MTSS1-ZC2HC1A |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |