UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:NARS-DAXX |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: NARS-DAXX | FusionPDB ID: 57289 | FusionGDB2.0 ID: 57289 | Hgene | Tgene | Gene symbol | NARS | DAXX | Gene ID | 4677 | 1616 |
Gene name | asparaginyl-tRNA synthetase 1 | death domain associated protein | |
Synonyms | ASNRS|NARS | BING2|DAP6|EAP1|SMIM40 | |
Cytomap | 18q21.31 | 6p21.32 | |
Type of gene | protein-coding | protein-coding | |
Description | asparagine--tRNA ligase, cytoplasmicasparagine tRNA ligase 1, cytoplasmicasparaginyl-tRNA synthetase, cytoplasmic | death domain-associated protein 6CENP-C binding proteinETS1-associated protein 1Fas-binding proteindeath-associated protein 6fas death domain-associated protein | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q96I59 | Q9UER7 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000256854, ENST00000423481, | ENST00000477162, ENST00000383062, ENST00000383194, ENST00000399060, ENST00000399344, ENST00000414388, ENST00000433482, ENST00000436311, ENST00000445009, ENST00000455860, ENST00000461796, ENST00000469277, ENST00000472399, ENST00000494562, ENST00000266000, ENST00000374542, ENST00000414083, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 6 X 6 X 2=72 | 7 X 4 X 5=140 |
# samples | 6 | 7 | |
** MAII score | log2(6/72*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(7/140*10)=-1 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: NARS [Title/Abstract] AND DAXX [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | NARS(55269587)-DAXX(33288237), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | NARS-DAXX seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NARS-DAXX seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. NARS-DAXX seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. NARS-DAXX seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. NARS-DAXX seems lost the major protein functional domain in Tgene partner, which is a epigenetic factor due to the frame-shifted ORF. NARS-DAXX seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | NARS | GO:0006421 | asparaginyl-tRNA aminoacylation | 9421509 |
Hgene | NARS | GO:0016477 | cell migration | 9421509 |
Tgene | DAXX | GO:0006334 | nucleosome assembly | 20504901|20651253 |
Tgene | DAXX | GO:0006338 | chromatin remodeling | 20651253 |
Tgene | DAXX | GO:0006355 | regulation of transcription, DNA-templated | 15878163 |
Tgene | DAXX | GO:0030521 | androgen receptor signaling pathway | 15572661 |
Tgene | DAXX | GO:0031396 | regulation of protein ubiquitination | 18566590 |
Tgene | DAXX | GO:0034605 | cellular response to heat | 15016915 |
Tgene | DAXX | GO:0034620 | cellular response to unfolded protein | 15016915 |
Tgene | DAXX | GO:0045892 | negative regulation of transcription, DNA-templated | 12140263|15572661 |
Tgene | DAXX | GO:0071276 | cellular response to cadmium ion | 15016915 |
Tgene | DAXX | GO:0071280 | cellular response to copper ion | 15016915 |
Tgene | DAXX | GO:0072738 | cellular response to diamide | 15016915 |
Tgene | DAXX | GO:1903936 | cellular response to sodium arsenite | 15016915 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-BR-A4PD-01A | NARS | chr18 | 55269587 | - | DAXX | chr6 | 33288237 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000423481 | NARS | chr18 | 55269587 | - | ENST00000266000 | DAXX | chr6 | 33288237 | - | 2412 | 1174 | 1572 | 2411 | 280 |
ENST00000423481 | NARS | chr18 | 55269587 | - | ENST00000374542 | DAXX | chr6 | 33288237 | - | 2412 | 1174 | 1572 | 2411 | 280 |
ENST00000423481 | NARS | chr18 | 55269587 | - | ENST00000414083 | DAXX | chr6 | 33288237 | - | 2251 | 1174 | 1411 | 2250 | 280 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000423481 | ENST00000266000 | NARS | chr18 | 55269587 | - | DAXX | chr6 | 33288237 | - | 0.005465948 | 0.994534 |
ENST00000423481 | ENST00000374542 | NARS | chr18 | 55269587 | - | DAXX | chr6 | 33288237 | - | 0.005465948 | 0.994534 |
ENST00000423481 | ENST00000414083 | NARS | chr18 | 55269587 | - | DAXX | chr6 | 33288237 | - | 0.005833893 | 0.99416614 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >57289_57289_1_NARS-DAXX_NARS_chr18_55269587_ENST00000423481_DAXX_chr6_33288237_ENST00000266000_length(amino acids)=280AA_BP=253 MHPFSSPAVPNPPFTASSAWYLQGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEEL TLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLG NRALVEWHPRGALLPPELRQMTKTMRRVMRKRRRRRKKKRRRPQILKRRRIWNRCRRVRRMMKRRTKRKKQQQRKKRRARLQGTSSHSAD -------------------------------------------------------------- >57289_57289_2_NARS-DAXX_NARS_chr18_55269587_ENST00000423481_DAXX_chr6_33288237_ENST00000374542_length(amino acids)=280AA_BP=253 MHPFSSPAVPNPPFTASSAWYLQGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEEL TLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLG NRALVEWHPRGALLPPELRQMTKTMRRVMRKRRRRRKKKRRRPQILKRRRIWNRCRRVRRMMKRRTKRKKQQQRKKRRARLQGTSSHSAD -------------------------------------------------------------- >57289_57289_3_NARS-DAXX_NARS_chr18_55269587_ENST00000423481_DAXX_chr6_33288237_ENST00000414083_length(amino acids)=280AA_BP=253 MHPFSSPAVPNPPFTASSAWYLQGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEEL TLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLG NRALVEWHPRGALLPPELRQMTKTMRRVMRKRRRRRKKKRRRPQILKRRRIWNRCRRVRRMMKRRTKRKKQQQRKKRRARLQGTSSHSAD -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr18:55269587/chr6:33288237) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
NARS | DAXX |
FUNCTION: Transcription corepressor known to repress transcriptional potential of several sumoylated transcription factors. Down-regulates basal and activated transcription. Its transcription repressor activity is modulated by recruiting it to subnuclear compartments like the nucleolus or PML/POD/ND10 nuclear bodies through interactions with MCSR1 and PML, respectively. Seems to regulate transcription in PML/POD/ND10 nuclear bodies together with PML and may influence TNFRSF6-dependent apoptosis thereby. Inhibits transcriptional activation of PAX3 and ETS1 through direct protein-protein interactions. Modulates PAX5 activity; the function seems to involve CREBBP. Acts as an adapter protein in a MDM2-DAXX-USP7 complex by regulating the RING-finger E3 ligase MDM2 ubiquitination activity. Under non-stress condition, in association with the deubiquitinating USP7, prevents MDM2 self-ubiquitination and enhances the intrinsic E3 ligase activity of MDM2 towards TP53, thereby promoting TP53 ubiquitination and subsequent proteasomal degradation. Upon DNA damage, its association with MDM2 and USP7 is disrupted, resulting in increased MDM2 autoubiquitination and consequently, MDM2 degradation, which leads to TP53 stabilization. Acts as histone chaperone that facilitates deposition of histone H3.3. Acts as targeting component of the chromatin remodeling complex ATRX:DAXX which has ATP-dependent DNA translocase activity and catalyzes the replication-independent deposition of histone H3.3 in pericentric DNA repeats outside S-phase and telomeres, and the in vitro remodeling of H3.3-containing nucleosomes. Does not affect the ATPase activity of ATRX but alleviates its transcription repression activity. Upon neuronal activation associates with regulatory elements of selected immediate early genes where it promotes deposition of histone H3.3 which may be linked to transcriptional induction of these genes. Required for the recruitment of histone H3.3:H4 dimers to PML-nuclear bodies (PML-NBs); the process is independent of ATRX and facilitated by ASF1A; PML-NBs are suggested to function as regulatory sites for the incorporation of newly synthesized histone H3.3 into chromatin. In case of overexpression of centromeric histone variant CENPA (as found in various tumors) is involved in its mislocalization to chromosomes; the ectopic localization involves a heterotypic tetramer containing CENPA, and histones H3.3 and H4 and decreases binding of CTCF to chromatin. Proposed to mediate activation of the JNK pathway and apoptosis via MAP3K5 in response to signaling from TNFRSF6 and TGFBR2. Interaction with HSPB1/HSP27 may prevent interaction with TNFRSF6 and MAP3K5 and block DAXX-mediated apoptosis. In contrast, in lymphoid cells JNC activation and TNFRSF6-mediated apoptosis may not involve DAXX. Shows restriction activity towards human cytomegalovirus (HCMV). Plays a role as a positive regulator of the heat shock transcription factor HSF1 activity during the stress protein response (PubMed:15016915). {ECO:0000269|PubMed:12140263, ECO:0000269|PubMed:14990586, ECO:0000269|PubMed:15016915, ECO:0000269|PubMed:15364927, ECO:0000269|PubMed:16845383, ECO:0000269|PubMed:17081986, ECO:0000269|PubMed:17942542, ECO:0000269|PubMed:20504901, ECO:0000269|PubMed:20651253, ECO:0000269|PubMed:23222847, ECO:0000269|PubMed:24200965, ECO:0000269|PubMed:24530302}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000266000 | 0 | 8 | 180_217 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000266000 | 0 | 8 | 358_399 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000266000 | 0 | 8 | 430_489 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000374542 | 0 | 8 | 180_217 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000374542 | 0 | 8 | 358_399 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000374542 | 0 | 8 | 430_489 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383062 | 0 | 8 | 180_217 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383062 | 0 | 8 | 358_399 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383062 | 0 | 8 | 430_489 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383194 | 0 | 8 | 180_217 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383194 | 0 | 8 | 358_399 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383194 | 0 | 8 | 430_489 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399060 | 0 | 8 | 180_217 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399060 | 0 | 8 | 358_399 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399060 | 0 | 8 | 430_489 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399344 | 0 | 8 | 180_217 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399344 | 0 | 8 | 358_399 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399344 | 0 | 8 | 430_489 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000414083 | 0 | 7 | 180_217 | 0 | 666.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000414083 | 0 | 7 | 358_399 | 0 | 666.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000414083 | 0 | 7 | 430_489 | 0 | 666.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000433482 | 0 | 8 | 180_217 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000433482 | 0 | 8 | 358_399 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000433482 | 0 | 8 | 430_489 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000436311 | 0 | 8 | 180_217 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000436311 | 0 | 8 | 358_399 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000436311 | 0 | 8 | 430_489 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000445009 | 0 | 8 | 180_217 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000445009 | 0 | 8 | 358_399 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000445009 | 0 | 8 | 430_489 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000455860 | 0 | 8 | 180_217 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000455860 | 0 | 8 | 358_399 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000455860 | 0 | 8 | 430_489 | 0 | 741.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000266000 | 0 | 8 | 11_16 | 0 | 741.0 | Compositional bias | Note=Poly-Asp | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000266000 | 0 | 8 | 434_572 | 0 | 741.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000374542 | 0 | 8 | 11_16 | 0 | 741.0 | Compositional bias | Note=Poly-Asp | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000374542 | 0 | 8 | 434_572 | 0 | 741.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383062 | 0 | 8 | 11_16 | 0 | 741.0 | Compositional bias | Note=Poly-Asp | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383062 | 0 | 8 | 434_572 | 0 | 741.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383194 | 0 | 8 | 11_16 | 0 | 741.0 | Compositional bias | Note=Poly-Asp | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383194 | 0 | 8 | 434_572 | 0 | 741.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399060 | 0 | 8 | 11_16 | 0 | 741.0 | Compositional bias | Note=Poly-Asp | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399060 | 0 | 8 | 434_572 | 0 | 741.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399344 | 0 | 8 | 11_16 | 0 | 741.0 | Compositional bias | Note=Poly-Asp | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399344 | 0 | 8 | 434_572 | 0 | 741.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000414083 | 0 | 7 | 11_16 | 0 | 666.0 | Compositional bias | Note=Poly-Asp | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000414083 | 0 | 7 | 434_572 | 0 | 666.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000433482 | 0 | 8 | 11_16 | 0 | 741.0 | Compositional bias | Note=Poly-Asp | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000433482 | 0 | 8 | 434_572 | 0 | 741.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000436311 | 0 | 8 | 11_16 | 0 | 741.0 | Compositional bias | Note=Poly-Asp | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000436311 | 0 | 8 | 434_572 | 0 | 741.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000445009 | 0 | 8 | 11_16 | 0 | 741.0 | Compositional bias | Note=Poly-Asp | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000445009 | 0 | 8 | 434_572 | 0 | 741.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000455860 | 0 | 8 | 11_16 | 0 | 741.0 | Compositional bias | Note=Poly-Asp | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000455860 | 0 | 8 | 434_572 | 0 | 741.0 | Compositional bias | Note=Asp/Glu-rich (acidic) | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000266000 | 0 | 8 | 391_395 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000266000 | 0 | 8 | 628_634 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000374542 | 0 | 8 | 391_395 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000374542 | 0 | 8 | 628_634 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383062 | 0 | 8 | 391_395 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383062 | 0 | 8 | 628_634 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383194 | 0 | 8 | 391_395 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000383194 | 0 | 8 | 628_634 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399060 | 0 | 8 | 391_395 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399060 | 0 | 8 | 628_634 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399344 | 0 | 8 | 391_395 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000399344 | 0 | 8 | 628_634 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000414083 | 0 | 7 | 391_395 | 0 | 666.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000414083 | 0 | 7 | 628_634 | 0 | 666.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000433482 | 0 | 8 | 391_395 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000433482 | 0 | 8 | 628_634 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000436311 | 0 | 8 | 391_395 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000436311 | 0 | 8 | 628_634 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000445009 | 0 | 8 | 391_395 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000445009 | 0 | 8 | 628_634 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000455860 | 0 | 8 | 391_395 | 0 | 741.0 | Motif | Nuclear localization signal | |
Tgene | DAXX | chr18:55269587 | chr6:33288237 | ENST00000455860 | 0 | 8 | 628_634 | 0 | 741.0 | Motif | Nuclear localization signal |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
NARS | |
DAXX |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to NARS-DAXX |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to NARS-DAXX |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |