UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:PABPC1-GRSF1 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: PABPC1-GRSF1 | FusionPDB ID: 62187 | FusionGDB2.0 ID: 62187 | Hgene | Tgene | Gene symbol | PABPC1 | GRSF1 | Gene ID | 26986 | 2926 |
Gene name | poly(A) binding protein cytoplasmic 1 | G-rich RNA sequence binding factor 1 | |
Synonyms | PAB1|PABP|PABP1|PABPC2|PABPL1 | - | |
Cytomap | 8q22.3 | 4q13.3 | |
Type of gene | protein-coding | protein-coding | |
Description | polyadenylate-binding protein 1poly(A) binding protein, cytoplasmic 2 | G-rich sequence factor 1 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | . | Q12849 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000318607, ENST00000519004, ENST00000522387, ENST00000519596, | ENST00000508091, ENST00000254799, ENST00000439371, ENST00000502323, ENST00000545193, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 31 X 28 X 11=9548 | 11 X 10 X 4=440 |
# samples | 37 | 11 | |
** MAII score | log2(37/9548*10)=-4.68960139056546 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(11/440*10)=-2 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: PABPC1 [Title/Abstract] AND GRSF1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | PABPC1(101730000)-GRSF1(71691148), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | PABPC1-GRSF1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. PABPC1-GRSF1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. PABPC1-GRSF1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. PABPC1-GRSF1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | PABPC1 | GO:2000623 | negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay | 18447585 |
Tgene | GRSF1 | GO:0000962 | positive regulation of mitochondrial RNA catabolic process | 29967381 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-SW-A7EA | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000318607 | PABPC1 | chr8 | 101730000 | - | ENST00000254799 | GRSF1 | chr4 | 71691148 | - | 6923 | 1632 | 1129 | 1794 | 221 |
ENST00000318607 | PABPC1 | chr8 | 101730000 | - | ENST00000439371 | GRSF1 | chr4 | 71691148 | - | 6918 | 1632 | 1129 | 1794 | 221 |
ENST00000318607 | PABPC1 | chr8 | 101730000 | - | ENST00000502323 | GRSF1 | chr4 | 71691148 | - | 2393 | 1632 | 1129 | 1794 | 221 |
ENST00000318607 | PABPC1 | chr8 | 101730000 | - | ENST00000545193 | GRSF1 | chr4 | 71691148 | - | 2330 | 1632 | 1129 | 1794 | 221 |
ENST00000519004 | PABPC1 | chr8 | 101730000 | - | ENST00000254799 | GRSF1 | chr4 | 71691148 | - | 6022 | 731 | 363 | 893 | 176 |
ENST00000519004 | PABPC1 | chr8 | 101730000 | - | ENST00000439371 | GRSF1 | chr4 | 71691148 | - | 6017 | 731 | 363 | 893 | 176 |
ENST00000519004 | PABPC1 | chr8 | 101730000 | - | ENST00000502323 | GRSF1 | chr4 | 71691148 | - | 1492 | 731 | 363 | 893 | 176 |
ENST00000519004 | PABPC1 | chr8 | 101730000 | - | ENST00000545193 | GRSF1 | chr4 | 71691148 | - | 1429 | 731 | 363 | 893 | 176 |
ENST00000522387 | PABPC1 | chr8 | 101730000 | - | ENST00000254799 | GRSF1 | chr4 | 71691148 | - | 6014 | 723 | 316 | 885 | 189 |
ENST00000522387 | PABPC1 | chr8 | 101730000 | - | ENST00000439371 | GRSF1 | chr4 | 71691148 | - | 6009 | 723 | 316 | 885 | 189 |
ENST00000522387 | PABPC1 | chr8 | 101730000 | - | ENST00000502323 | GRSF1 | chr4 | 71691148 | - | 1484 | 723 | 316 | 885 | 189 |
ENST00000522387 | PABPC1 | chr8 | 101730000 | - | ENST00000545193 | GRSF1 | chr4 | 71691148 | - | 1421 | 723 | 316 | 885 | 189 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000318607 | ENST00000254799 | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - | 0.000470586 | 0.9995295 |
ENST00000318607 | ENST00000439371 | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - | 0.000456025 | 0.99954396 |
ENST00000318607 | ENST00000502323 | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - | 0.002395175 | 0.99760485 |
ENST00000318607 | ENST00000545193 | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - | 0.002723405 | 0.9972766 |
ENST00000519004 | ENST00000254799 | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - | 0.004750941 | 0.99524903 |
ENST00000519004 | ENST00000439371 | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - | 0.004517912 | 0.9954821 |
ENST00000519004 | ENST00000502323 | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - | 0.007146679 | 0.99285334 |
ENST00000519004 | ENST00000545193 | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - | 0.007937769 | 0.9920622 |
ENST00000522387 | ENST00000254799 | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - | 0.000636421 | 0.9993636 |
ENST00000522387 | ENST00000439371 | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - | 0.000605067 | 0.9993949 |
ENST00000522387 | ENST00000502323 | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - | 0.001798164 | 0.99820185 |
ENST00000522387 | ENST00000545193 | PABPC1 | chr8 | 101730000 | - | GRSF1 | chr4 | 71691148 | - | 0.002385687 | 0.9976144 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >62187_62187_1_PABPC1-GRSF1_PABPC1_chr8_101730000_ENST00000318607_GRSF1_chr4_71691148_ENST00000254799_length(amino acids)=221AA_BP=168 MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRD PSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFLLHSSLLESPW -------------------------------------------------------------- >62187_62187_2_PABPC1-GRSF1_PABPC1_chr8_101730000_ENST00000318607_GRSF1_chr4_71691148_ENST00000439371_length(amino acids)=221AA_BP=168 MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRD PSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFLLHSSLLESPW -------------------------------------------------------------- >62187_62187_3_PABPC1-GRSF1_PABPC1_chr8_101730000_ENST00000318607_GRSF1_chr4_71691148_ENST00000502323_length(amino acids)=221AA_BP=168 MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRD PSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFLLHSSLLESPW -------------------------------------------------------------- >62187_62187_4_PABPC1-GRSF1_PABPC1_chr8_101730000_ENST00000318607_GRSF1_chr4_71691148_ENST00000545193_length(amino acids)=221AA_BP=168 MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRD PSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFLLHSSLLESPW -------------------------------------------------------------- >62187_62187_5_PABPC1-GRSF1_PABPC1_chr8_101730000_ENST00000519004_GRSF1_chr4_71691148_ENST00000254799_length(amino acids)=176AA_BP=123 MITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN -------------------------------------------------------------- >62187_62187_6_PABPC1-GRSF1_PABPC1_chr8_101730000_ENST00000519004_GRSF1_chr4_71691148_ENST00000439371_length(amino acids)=176AA_BP=123 MITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN -------------------------------------------------------------- >62187_62187_7_PABPC1-GRSF1_PABPC1_chr8_101730000_ENST00000519004_GRSF1_chr4_71691148_ENST00000502323_length(amino acids)=176AA_BP=123 MITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN -------------------------------------------------------------- >62187_62187_8_PABPC1-GRSF1_PABPC1_chr8_101730000_ENST00000519004_GRSF1_chr4_71691148_ENST00000545193_length(amino acids)=176AA_BP=123 MITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDEN -------------------------------------------------------------- >62187_62187_9_PABPC1-GRSF1_PABPC1_chr8_101730000_ENST00000522387_GRSF1_chr4_71691148_ENST00000254799_length(amino acids)=189AA_BP=136 MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRD PSLRKSGVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFLLHSSLLESPWNTAPVGRPLEKLMCTLRPMRMLLQRCSRIGPT -------------------------------------------------------------- >62187_62187_10_PABPC1-GRSF1_PABPC1_chr8_101730000_ENST00000522387_GRSF1_chr4_71691148_ENST00000439371_length(amino acids)=189AA_BP=136 MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRD PSLRKSGVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFLLHSSLLESPWNTAPVGRPLEKLMCTLRPMRMLLQRCSRIGPT -------------------------------------------------------------- >62187_62187_11_PABPC1-GRSF1_PABPC1_chr8_101730000_ENST00000522387_GRSF1_chr4_71691148_ENST00000502323_length(amino acids)=189AA_BP=136 MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRD PSLRKSGVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFLLHSSLLESPWNTAPVGRPLEKLMCTLRPMRMLLQRCSRIGPT -------------------------------------------------------------- >62187_62187_12_PABPC1-GRSF1_PABPC1_chr8_101730000_ENST00000522387_GRSF1_chr4_71691148_ENST00000545193_length(amino acids)=189AA_BP=136 MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRD PSLRKSGVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFLLHSSLLESPWNTAPVGRPLEKLMCTLRPMRMLLQRCSRIGPT -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr8:101730000/chr4:71691148) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | GRSF1 |
FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Regulator of post-transcriptional mitochondrial gene expression, required for assembly of the mitochondrial ribosome and for recruitment of mRNA and lncRNA. Binds RNAs containing the 14 base G-rich element. Preferentially binds RNAs transcribed from three contiguous genes on the light strand of mtDNA, the ND6 mRNA, and the long non-coding RNAs for MT-CYB and MT-ND5, each of which contains multiple consensus binding sequences (PubMed:23473033, PubMed:23473034, PubMed:29967381). Involved in the degradosome-mediated decay of non-coding mitochondrial transcripts (MT-ncRNA) and tRNA-like molecules (PubMed:29967381). Acts by unwinding G-quadruplex RNA structures in MT-ncRNA, thus facilitating their degradation by the degradosome (PubMed:29967381). G-quadruplexes (G4) are non-canonical 4 stranded structures formed by transcripts from the light strand of mtDNA (PubMed:29967381). {ECO:0000269|PubMed:23473033, ECO:0000269|PubMed:23473034, ECO:0000269|PubMed:29967381}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | PABPC1 | chr8:101730000 | chr4:71691148 | ENST00000318607 | - | 3 | 15 | 11_89 | 167.66666666666666 | 311.0 | Domain | RRM 1 |
Tgene | GRSF1 | chr8:101730000 | chr4:71691148 | ENST00000439371 | 6 | 10 | 401_480 | 257.0 | 1891.3333333333333 | Domain | RRM 3 | |
Tgene | GRSF1 | chr8:101730000 | chr4:71691148 | ENST00000502323 | 6 | 10 | 401_480 | 257.0 | 430.6666666666667 | Domain | RRM 3 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | PABPC1 | chr8:101730000 | chr4:71691148 | ENST00000318607 | - | 3 | 15 | 495_501 | 167.66666666666666 | 311.0 | Compositional bias | Note=Poly-Ala |
Hgene | PABPC1 | chr8:101730000 | chr4:71691148 | ENST00000318607 | - | 3 | 15 | 191_268 | 167.66666666666666 | 311.0 | Domain | RRM 3 |
Hgene | PABPC1 | chr8:101730000 | chr4:71691148 | ENST00000318607 | - | 3 | 15 | 294_370 | 167.66666666666666 | 311.0 | Domain | RRM 4 |
Hgene | PABPC1 | chr8:101730000 | chr4:71691148 | ENST00000318607 | - | 3 | 15 | 542_619 | 167.66666666666666 | 311.0 | Domain | PABC |
Hgene | PABPC1 | chr8:101730000 | chr4:71691148 | ENST00000318607 | - | 3 | 15 | 99_175 | 167.66666666666666 | 311.0 | Domain | RRM 2 |
Hgene | PABPC1 | chr8:101730000 | chr4:71691148 | ENST00000318607 | - | 3 | 15 | 166_289 | 167.66666666666666 | 311.0 | Region | Note=CSDE1-binding |
Hgene | PABPC1 | chr8:101730000 | chr4:71691148 | ENST00000318607 | - | 3 | 15 | 541_636 | 167.66666666666666 | 311.0 | Region | (Microbial infection) Binding to HRSV M2-1 protein |
Tgene | GRSF1 | chr8:101730000 | chr4:71691148 | ENST00000254799 | 6 | 10 | 55_111 | 419.0 | 1988.6666666666667 | Compositional bias | Note=Ala-rich | |
Tgene | GRSF1 | chr8:101730000 | chr4:71691148 | ENST00000439371 | 6 | 10 | 55_111 | 257.0 | 1891.3333333333333 | Compositional bias | Note=Ala-rich | |
Tgene | GRSF1 | chr8:101730000 | chr4:71691148 | ENST00000502323 | 6 | 10 | 55_111 | 257.0 | 430.6666666666667 | Compositional bias | Note=Ala-rich | |
Tgene | GRSF1 | chr8:101730000 | chr4:71691148 | ENST00000254799 | 6 | 10 | 122_246 | 419.0 | 1988.6666666666667 | Domain | RRM 1 | |
Tgene | GRSF1 | chr8:101730000 | chr4:71691148 | ENST00000254799 | 6 | 10 | 250_326 | 419.0 | 1988.6666666666667 | Domain | RRM 2 | |
Tgene | GRSF1 | chr8:101730000 | chr4:71691148 | ENST00000254799 | 6 | 10 | 401_480 | 419.0 | 1988.6666666666667 | Domain | RRM 3 | |
Tgene | GRSF1 | chr8:101730000 | chr4:71691148 | ENST00000439371 | 6 | 10 | 122_246 | 257.0 | 1891.3333333333333 | Domain | RRM 1 | |
Tgene | GRSF1 | chr8:101730000 | chr4:71691148 | ENST00000439371 | 6 | 10 | 250_326 | 257.0 | 1891.3333333333333 | Domain | RRM 2 | |
Tgene | GRSF1 | chr8:101730000 | chr4:71691148 | ENST00000502323 | 6 | 10 | 122_246 | 257.0 | 430.6666666666667 | Domain | RRM 1 | |
Tgene | GRSF1 | chr8:101730000 | chr4:71691148 | ENST00000502323 | 6 | 10 | 250_326 | 257.0 | 430.6666666666667 | Domain | RRM 2 |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
PABPC1 | |
GRSF1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to PABPC1-GRSF1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to PABPC1-GRSF1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |