UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:PARK7-GNB1 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: PARK7-GNB1 | FusionPDB ID: 62768 | FusionGDB2.0 ID: 62768 | Hgene | Tgene | Gene symbol | PARK7 | GNB1 | Gene ID | 11315 | 2782 |
Gene name | Parkinsonism associated deglycase | G protein subunit beta 1 | |
Synonyms | DJ-1|DJ1|GATD2|HEL-S-67p | MRD42 | |
Cytomap | 1p36.23 | 1p36.33 | |
Type of gene | protein-coding | protein-coding | |
Description | protein/nucleic acid deglycase DJ-1Parkinson disease (autosomal recessive, early onset) 7epididymis secretory sperm binding protein Li 67pmaillard deglycaseoncogene DJ1parkinson protein 7protein DJ-1protein deglycase DJ-1 | guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1beta subunit, signal-transducing proteins GS/GIguanine nucleotide binding protein (G protein), beta polypeptide 1testicular tissue protein Li 72transducin beta chain 1 | |
Modification date | 20200327 | 20200321 | |
UniProtAcc | . | Q9BYB4 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000497113, ENST00000338639, ENST00000377488, ENST00000377491, ENST00000377493, ENST00000493678, | ENST00000378609, ENST00000472614, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 5 X 5 X 4=100 | 39 X 29 X 13=14703 |
# samples | 6 | 48 | |
** MAII score | log2(6/100*10)=-0.736965594166206 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(48/14703*10)=-4.93693233652239 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: PARK7 [Title/Abstract] AND GNB1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | PARK7(8022935)-GNB1(1749314), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | PARK7 | GO:0006281 | DNA repair | 28596309 |
Hgene | PARK7 | GO:0006517 | protein deglycosylation | 25416785 |
Hgene | PARK7 | GO:0006517 | protein deglycosylation | 27903648 |
Hgene | PARK7 | GO:0009438 | methylglyoxal metabolic process | 22523093 |
Hgene | PARK7 | GO:0009438 | methylglyoxal metabolic process | 27903648 |
Hgene | PARK7 | GO:0010629 | negative regulation of gene expression | 22683601 |
Hgene | PARK7 | GO:0019249 | lactate biosynthetic process | 22523093 |
Hgene | PARK7 | GO:0031334 | positive regulation of protein complex assembly | 24947010 |
Hgene | PARK7 | GO:0031397 | negative regulation of protein ubiquitination | 17015834|24899725 |
Hgene | PARK7 | GO:0032091 | negative regulation of protein binding | 11477070|16731528|17015834|24899725 |
Hgene | PARK7 | GO:0032435 | negative regulation of proteasomal ubiquitin-dependent protein catabolic process | 17015834 |
Hgene | PARK7 | GO:0032757 | positive regulation of interleukin-8 production | 21097510 |
Hgene | PARK7 | GO:0033234 | negative regulation of protein sumoylation | 16731528 |
Hgene | PARK7 | GO:0034599 | cellular response to oxidative stress | 15983381|19703902|20969476|22683601 |
Hgene | PARK7 | GO:0036471 | cellular response to glyoxal | 22523093 |
Hgene | PARK7 | GO:0036526 | peptidyl-cysteine deglycation | 25416785 |
Hgene | PARK7 | GO:0036527 | peptidyl-arginine deglycation | 25416785 |
Hgene | PARK7 | GO:0036528 | peptidyl-lysine deglycation | 25416785 |
Hgene | PARK7 | GO:0036529 | protein deglycation, glyoxal removal | 25416785 |
Hgene | PARK7 | GO:0036530 | protein deglycation, methylglyoxal removal | 25416785 |
Hgene | PARK7 | GO:0036530 | protein deglycation, methylglyoxal removal | 27903648 |
Hgene | PARK7 | GO:0036531 | glutathione deglycation | 25416785 |
Hgene | PARK7 | GO:0042743 | hydrogen peroxide metabolic process | 20969476|24567322 |
Hgene | PARK7 | GO:0043066 | negative regulation of apoptotic process | 22523093 |
Hgene | PARK7 | GO:0043523 | regulation of neuron apoptotic process | 18711745|20304780 |
Hgene | PARK7 | GO:0043524 | negative regulation of neuron apoptotic process | 22511790 |
Hgene | PARK7 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 21097510 |
Hgene | PARK7 | GO:0046295 | glycolate biosynthetic process | 22523093 |
Hgene | PARK7 | GO:0050821 | protein stabilization | 24947010 |
Hgene | PARK7 | GO:0051444 | negative regulation of ubiquitin-protein transferase activity | 24899725 |
Hgene | PARK7 | GO:0060548 | negative regulation of cell death | 14749723 |
Hgene | PARK7 | GO:0060765 | regulation of androgen receptor signaling pathway | 11477070 |
Hgene | PARK7 | GO:0070301 | cellular response to hydrogen peroxide | 14749723 |
Hgene | PARK7 | GO:0106044 | guanine deglycation | 28596309 |
Hgene | PARK7 | GO:0106045 | guanine deglycation, methylglyoxal removal | 28596309 |
Hgene | PARK7 | GO:0106046 | guanine deglycation, glyoxal removal | 28596309 |
Hgene | PARK7 | GO:1900182 | positive regulation of protein localization to nucleus | 21097510 |
Hgene | PARK7 | GO:1901215 | negative regulation of neuron death | 22683601 |
Hgene | PARK7 | GO:1901671 | positive regulation of superoxide dismutase activity | 24567322 |
Hgene | PARK7 | GO:1901984 | negative regulation of protein acetylation | 22683601 |
Hgene | PARK7 | GO:1903094 | negative regulation of protein K48-linked deubiquitination | 21097510 |
Hgene | PARK7 | GO:1903168 | positive regulation of pyrroline-5-carboxylate reductase activity | 23743200 |
Hgene | PARK7 | GO:1903178 | positive regulation of tyrosine 3-monooxygenase activity | 19703902 |
Hgene | PARK7 | GO:1903181 | positive regulation of dopamine biosynthetic process | 19703902 |
Hgene | PARK7 | GO:1903189 | glyoxal metabolic process | 22523093 |
Hgene | PARK7 | GO:1903200 | positive regulation of L-dopa decarboxylase activity | 19703902 |
Hgene | PARK7 | GO:1903202 | negative regulation of oxidative stress-induced cell death | 16632486 |
Hgene | PARK7 | GO:1903208 | negative regulation of hydrogen peroxide-induced neuron death | 15983381|24947010 |
Hgene | PARK7 | GO:1903377 | negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway | 15790595 |
Hgene | PARK7 | GO:1905259 | negative regulation of nitrosative stress-induced intrinsic apoptotic signaling pathway | 14752510 |
Hgene | PARK7 | GO:2000157 | negative regulation of ubiquitin-specific protease activity | 21097510 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | GBM | TCGA-32-2632-01A | PARK7 | chr1 | 8022935 | + | GNB1 | chr1 | 1749314 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000338639 | PARK7 | chr1 | 8022935 | + | ENST00000378609 | GNB1 | chr1 | 1749314 | - | 2983 | 244 | 154 | 1209 | 351 |
ENST00000493678 | PARK7 | chr1 | 8022935 | + | ENST00000378609 | GNB1 | chr1 | 1749314 | - | 2896 | 157 | 67 | 1122 | 351 |
ENST00000377493 | PARK7 | chr1 | 8022935 | + | ENST00000378609 | GNB1 | chr1 | 1749314 | - | 2887 | 148 | 58 | 1113 | 351 |
ENST00000377491 | PARK7 | chr1 | 8022935 | + | ENST00000378609 | GNB1 | chr1 | 1749314 | - | 3040 | 301 | 211 | 1266 | 351 |
ENST00000377488 | PARK7 | chr1 | 8022935 | + | ENST00000378609 | GNB1 | chr1 | 1749314 | - | 2985 | 246 | 156 | 1211 | 351 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000338639 | ENST00000378609 | PARK7 | chr1 | 8022935 | + | GNB1 | chr1 | 1749314 | - | 0.00240096 | 0.99759907 |
ENST00000493678 | ENST00000378609 | PARK7 | chr1 | 8022935 | + | GNB1 | chr1 | 1749314 | - | 0.002502461 | 0.9974975 |
ENST00000377493 | ENST00000378609 | PARK7 | chr1 | 8022935 | + | GNB1 | chr1 | 1749314 | - | 0.002410559 | 0.99758947 |
ENST00000377491 | ENST00000378609 | PARK7 | chr1 | 8022935 | + | GNB1 | chr1 | 1749314 | - | 0.002751223 | 0.9972487 |
ENST00000377488 | ENST00000378609 | PARK7 | chr1 | 8022935 | + | GNB1 | chr1 | 1749314 | - | 0.002567251 | 0.99743277 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >62768_62768_1_PARK7-GNB1_PARK7_chr1_8022935_ENST00000338639_GNB1_chr1_1749314_ENST00000378609_length(amino acids)=351AA_BP=30 MASKRALVILAKGAEEMETVIPVDVMRRAGDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKL IIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALW DIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQ -------------------------------------------------------------- >62768_62768_2_PARK7-GNB1_PARK7_chr1_8022935_ENST00000377488_GNB1_chr1_1749314_ENST00000378609_length(amino acids)=351AA_BP=30 MASKRALVILAKGAEEMETVIPVDVMRRAGDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKL IIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALW DIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQ -------------------------------------------------------------- >62768_62768_3_PARK7-GNB1_PARK7_chr1_8022935_ENST00000377491_GNB1_chr1_1749314_ENST00000378609_length(amino acids)=351AA_BP=30 MASKRALVILAKGAEEMETVIPVDVMRRAGDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKL IIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALW DIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQ -------------------------------------------------------------- >62768_62768_4_PARK7-GNB1_PARK7_chr1_8022935_ENST00000377493_GNB1_chr1_1749314_ENST00000378609_length(amino acids)=351AA_BP=30 MASKRALVILAKGAEEMETVIPVDVMRRAGDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKL IIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALW DIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQ -------------------------------------------------------------- >62768_62768_5_PARK7-GNB1_PARK7_chr1_8022935_ENST00000493678_GNB1_chr1_1749314_ENST00000378609_length(amino acids)=351AA_BP=30 MASKRALVILAKGAEEMETVIPVDVMRRAGDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKL IIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALW DIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQ -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:8022935/chr1:1749314) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | GNB1 |
FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | GNB1 | chr1:8022935 | chr1:1749314 | ENST00000378609 | 2 | 12 | 141_170 | 19.0 | 872.3333333333334 | Repeat | Note=WD 3 | |
Tgene | GNB1 | chr1:8022935 | chr1:1749314 | ENST00000378609 | 2 | 12 | 182_212 | 19.0 | 872.3333333333334 | Repeat | Note=WD 4 | |
Tgene | GNB1 | chr1:8022935 | chr1:1749314 | ENST00000378609 | 2 | 12 | 224_254 | 19.0 | 872.3333333333334 | Repeat | Note=WD 5 | |
Tgene | GNB1 | chr1:8022935 | chr1:1749314 | ENST00000378609 | 2 | 12 | 268_298 | 19.0 | 872.3333333333334 | Repeat | Note=WD 6 | |
Tgene | GNB1 | chr1:8022935 | chr1:1749314 | ENST00000378609 | 2 | 12 | 310_340 | 19.0 | 872.3333333333334 | Repeat | Note=WD 7 | |
Tgene | GNB1 | chr1:8022935 | chr1:1749314 | ENST00000378609 | 2 | 12 | 53_83 | 19.0 | 872.3333333333334 | Repeat | Note=WD 1 | |
Tgene | GNB1 | chr1:8022935 | chr1:1749314 | ENST00000378609 | 2 | 12 | 95_125 | 19.0 | 872.3333333333334 | Repeat | Note=WD 2 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
PARK7 | |
GNB1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to PARK7-GNB1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to PARK7-GNB1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |