UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Fusion Protein:PBX1-RFWD2 |
Fusion Protein Summary |
Fusion gene summary |
Fusion partner gene information | Fusion gene name: PBX1-RFWD2 | FusionPDB ID: 63030 | FusionGDB2.0 ID: 63030 | Hgene | Tgene | Gene symbol | PBX1 | RFWD2 | Gene ID | 5087 | 64326 |
Gene name | PBX homeobox 1 | COP1 E3 ubiquitin ligase | |
Synonyms | CAKUHED | CFAP78|FAP78|RFWD2|RNF200 | |
Cytomap | 1q23.3 | 1q25.1-q25.2 | |
Type of gene | protein-coding | protein-coding | |
Description | pre-B-cell leukemia transcription factor 1homeobox protein PBX1homeobox protein PRLpre-B-cell leukemia homeobox 1 | E3 ubiquitin-protein ligase COP1E3 ubiquitin-protein ligase RFWD2RING finger protein 200RING-type E3 ubiquitin transferase RFWD2constitutive photomorphogenesis protein 1 homologconstitutive photomorphogenic protein 1putative ubiquitin ligase COP1ri | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | P40424 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000367897, ENST00000401534, ENST00000420696, ENST00000540236, ENST00000559240, ENST00000474046, ENST00000485769, ENST00000540246, ENST00000560641, | ENST00000308769, ENST00000367669, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 16 X 10 X 5=800 | 28 X 17 X 12=5712 |
# samples | 21 | 27 | |
** MAII score | log2(21/800*10)=-1.9296106721086 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(27/5712*10)=-4.40296466697827 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: PBX1 [Title/Abstract] AND RFWD2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | PBX1(164532548)-RFWD2(175958615), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | PBX1-RFWD2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. PBX1-RFWD2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. PBX1-RFWD2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. PBX1-RFWD2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | RFWD2 | GO:0010212 | response to ionizing radiation | 19805145 |
Fusion gene breakpoints across PBX1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across RFWD2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | SARC | TCGA-DX-A6YR-01A | PBX1 | chr1 | 164532548 | - | RFWD2 | chr1 | 175958615 | - |
ChimerDB4 | SARC | TCGA-DX-A6YR-01A | PBX1 | chr1 | 164532548 | + | RFWD2 | chr1 | 175958615 | - |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000420696 | PBX1 | chr1 | 164532548 | + | ENST00000367669 | RFWD2 | chr1 | 175958615 | - | 1242 | 453 | 182 | 919 | 245 |
ENST00000420696 | PBX1 | chr1 | 164532548 | + | ENST00000308769 | RFWD2 | chr1 | 175958615 | - | 920 | 453 | 182 | 919 | 246 |
ENST00000401534 | PBX1 | chr1 | 164532548 | + | ENST00000367669 | RFWD2 | chr1 | 175958615 | - | 1054 | 265 | 0 | 731 | 243 |
ENST00000401534 | PBX1 | chr1 | 164532548 | + | ENST00000308769 | RFWD2 | chr1 | 175958615 | - | 732 | 265 | 0 | 731 | 243 |
ENST00000559240 | PBX1 | chr1 | 164532548 | + | ENST00000367669 | RFWD2 | chr1 | 175958615 | - | 1054 | 265 | 0 | 731 | 243 |
ENST00000559240 | PBX1 | chr1 | 164532548 | + | ENST00000308769 | RFWD2 | chr1 | 175958615 | - | 732 | 265 | 0 | 731 | 243 |
ENST00000367897 | PBX1 | chr1 | 164532548 | + | ENST00000367669 | RFWD2 | chr1 | 175958615 | - | 1054 | 265 | 0 | 731 | 243 |
ENST00000367897 | PBX1 | chr1 | 164532548 | + | ENST00000308769 | RFWD2 | chr1 | 175958615 | - | 732 | 265 | 0 | 731 | 243 |
ENST00000540236 | PBX1 | chr1 | 164532548 | + | ENST00000367669 | RFWD2 | chr1 | 175958615 | - | 1054 | 265 | 0 | 731 | 243 |
ENST00000540236 | PBX1 | chr1 | 164532548 | + | ENST00000308769 | RFWD2 | chr1 | 175958615 | - | 732 | 265 | 0 | 731 | 243 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000420696 | ENST00000367669 | PBX1 | chr1 | 164532548 | + | RFWD2 | chr1 | 175958615 | - | 0.000861753 | 0.99913824 |
ENST00000420696 | ENST00000308769 | PBX1 | chr1 | 164532548 | + | RFWD2 | chr1 | 175958615 | - | 0.001136903 | 0.9988631 |
ENST00000401534 | ENST00000367669 | PBX1 | chr1 | 164532548 | + | RFWD2 | chr1 | 175958615 | - | 0.000682498 | 0.9993175 |
ENST00000401534 | ENST00000308769 | PBX1 | chr1 | 164532548 | + | RFWD2 | chr1 | 175958615 | - | 0.000987717 | 0.99901223 |
ENST00000559240 | ENST00000367669 | PBX1 | chr1 | 164532548 | + | RFWD2 | chr1 | 175958615 | - | 0.000682498 | 0.9993175 |
ENST00000559240 | ENST00000308769 | PBX1 | chr1 | 164532548 | + | RFWD2 | chr1 | 175958615 | - | 0.000987717 | 0.99901223 |
ENST00000367897 | ENST00000367669 | PBX1 | chr1 | 164532548 | + | RFWD2 | chr1 | 175958615 | - | 0.000682498 | 0.9993175 |
ENST00000367897 | ENST00000308769 | PBX1 | chr1 | 164532548 | + | RFWD2 | chr1 | 175958615 | - | 0.000987717 | 0.99901223 |
ENST00000540236 | ENST00000367669 | PBX1 | chr1 | 164532548 | + | RFWD2 | chr1 | 175958615 | - | 0.000682498 | 0.9993175 |
ENST00000540236 | ENST00000308769 | PBX1 | chr1 | 164532548 | + | RFWD2 | chr1 | 175958615 | - | 0.000987717 | 0.99901223 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >63030_63030_1_PBX1-RFWD2_PBX1_chr1_164532548_ENST00000367897_RFWD2_chr1_175958615_ENST00000308769_length(amino acids)=243AA_BP=88 MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTDH CVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYY -------------------------------------------------------------- >63030_63030_2_PBX1-RFWD2_PBX1_chr1_164532548_ENST00000367897_RFWD2_chr1_175958615_ENST00000367669_length(amino acids)=243AA_BP=88 MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTDH CVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYY -------------------------------------------------------------- >63030_63030_3_PBX1-RFWD2_PBX1_chr1_164532548_ENST00000401534_RFWD2_chr1_175958615_ENST00000308769_length(amino acids)=243AA_BP=88 MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTDH CVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYY -------------------------------------------------------------- >63030_63030_4_PBX1-RFWD2_PBX1_chr1_164532548_ENST00000401534_RFWD2_chr1_175958615_ENST00000367669_length(amino acids)=243AA_BP=88 MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTDH CVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYY -------------------------------------------------------------- >63030_63030_5_PBX1-RFWD2_PBX1_chr1_164532548_ENST00000420696_RFWD2_chr1_175958615_ENST00000308769_length(amino acids)=246AA_BP=90 MEMDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKT DHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYL -------------------------------------------------------------- >63030_63030_6_PBX1-RFWD2_PBX1_chr1_164532548_ENST00000420696_RFWD2_chr1_175958615_ENST00000367669_length(amino acids)=245AA_BP=90 MEMDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKT DHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYL -------------------------------------------------------------- >63030_63030_7_PBX1-RFWD2_PBX1_chr1_164532548_ENST00000540236_RFWD2_chr1_175958615_ENST00000308769_length(amino acids)=243AA_BP=88 MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTDH CVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYY -------------------------------------------------------------- >63030_63030_8_PBX1-RFWD2_PBX1_chr1_164532548_ENST00000540236_RFWD2_chr1_175958615_ENST00000367669_length(amino acids)=243AA_BP=88 MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTDH CVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYY -------------------------------------------------------------- >63030_63030_9_PBX1-RFWD2_PBX1_chr1_164532548_ENST00000559240_RFWD2_chr1_175958615_ENST00000308769_length(amino acids)=243AA_BP=88 MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTDH CVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYY -------------------------------------------------------------- >63030_63030_10_PBX1-RFWD2_PBX1_chr1_164532548_ENST00000559240_RFWD2_chr1_175958615_ENST00000367669_length(amino acids)=243AA_BP=88 MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTDH CVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYY -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:164532548/chr1:175958615) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
PBX1 | . |
FUNCTION: Transcription factor which binds the DNA sequence 5'-TGATTGAT-3' as part of a heterodimer with HOX proteins such as HOXA1, HOXA5, HOXB7 and HOXB8 (PubMed:9191052). Binds to the DNA sequence 5'-TGATTGAC-3' in complex with a nuclear factor which is not a class I HOX protein (PubMed:9191052). Has also been shown to bind the DNA sequence 5'-ATCAATCAA-3' cooperatively with HOXA5, HOXB7, HOXB8, HOXC8 and HOXD4 (PubMed:8327485, PubMed:7791786). Acts as a transcriptional activator of PF4 in complex with MEIS1 (PubMed:12609849). Also activates transcription of SOX3 in complex with MEIS1 by binding to the 5'-TGATTGAC-3' consensus sequence (By similarity). In natural killer cells, binds to the NFIL3 promoter and acts as a transcriptional activator of NFIL3, promoting natural killer cell development (By similarity). Plays a role in the cAMP-dependent regulation of CYP17A1 gene expression via its cAMP-regulatory sequence (CRS1) (By similarity). Probably in complex with MEIS2, involved in transcriptional regulation by KLF4 (PubMed:21746878). Acts as a transcriptional activator of NKX2-5 and a transcriptional repressor of CDKN2B (By similarity). Together with NKX2-5, required for spleen development through a mechanism that involves CDKN2B repression (By similarity). {ECO:0000250|UniProtKB:P41778, ECO:0000269|PubMed:12609849, ECO:0000269|PubMed:21746878, ECO:0000269|PubMed:7791786, ECO:0000269|PubMed:8327485, ECO:0000269|PubMed:9191052}.; FUNCTION: [Isoform PBX1b]: As part of a PDX1:PBX1b:MEIS2B complex in pancreatic acinar cells, is involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element. {ECO:0000250|UniProtKB:P41778}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 553_593 | 552.3333333333334 | 708.0 | Repeat | Note=WD 4 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 597_635 | 552.3333333333334 | 708.0 | Repeat | Note=WD 5 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 638_677 | 552.3333333333334 | 708.0 | Repeat | Note=WD 6 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 691_729 | 552.3333333333334 | 708.0 | Repeat | Note=WD 7 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 597_635 | 576.3333333333334 | 732.0 | Repeat | Note=WD 5 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 638_677 | 576.3333333333334 | 732.0 | Repeat | Note=WD 6 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 691_729 | 576.3333333333334 | 732.0 | Repeat | Note=WD 7 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | PBX1 | chr1:164532548 | chr1:175958615 | ENST00000367897 | + | 2 | 8 | 127_135 | 88.33333333333333 | 408.3333333333333 | Compositional bias | Note=Poly-Ala |
Hgene | PBX1 | chr1:164532548 | chr1:175958615 | ENST00000401534 | + | 2 | 7 | 127_135 | 88.33333333333333 | 348.0 | Compositional bias | Note=Poly-Ala |
Hgene | PBX1 | chr1:164532548 | chr1:175958615 | ENST00000420696 | + | 2 | 9 | 127_135 | 88.33333333333333 | 431.0 | Compositional bias | Note=Poly-Ala |
Hgene | PBX1 | chr1:164532548 | chr1:175958615 | ENST00000540236 | + | 2 | 9 | 127_135 | 88.33333333333333 | 421.0 | Compositional bias | Note=Poly-Ala |
Hgene | PBX1 | chr1:164532548 | chr1:175958615 | ENST00000367897 | + | 2 | 8 | 233_295 | 88.33333333333333 | 408.3333333333333 | DNA binding | Homeobox%3B TALE-type |
Hgene | PBX1 | chr1:164532548 | chr1:175958615 | ENST00000401534 | + | 2 | 7 | 233_295 | 88.33333333333333 | 348.0 | DNA binding | Homeobox%3B TALE-type |
Hgene | PBX1 | chr1:164532548 | chr1:175958615 | ENST00000420696 | + | 2 | 9 | 233_295 | 88.33333333333333 | 431.0 | DNA binding | Homeobox%3B TALE-type |
Hgene | PBX1 | chr1:164532548 | chr1:175958615 | ENST00000540236 | + | 2 | 9 | 233_295 | 88.33333333333333 | 421.0 | DNA binding | Homeobox%3B TALE-type |
Hgene | PBX1 | chr1:164532548 | chr1:175958615 | ENST00000367897 | + | 2 | 8 | 40_232 | 88.33333333333333 | 408.3333333333333 | Domain | PBC |
Hgene | PBX1 | chr1:164532548 | chr1:175958615 | ENST00000401534 | + | 2 | 7 | 40_232 | 88.33333333333333 | 348.0 | Domain | PBC |
Hgene | PBX1 | chr1:164532548 | chr1:175958615 | ENST00000420696 | + | 2 | 9 | 40_232 | 88.33333333333333 | 431.0 | Domain | PBC |
Hgene | PBX1 | chr1:164532548 | chr1:175958615 | ENST00000540236 | + | 2 | 9 | 40_232 | 88.33333333333333 | 421.0 | Domain | PBC |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 233_301 | 552.3333333333334 | 708.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 233_301 | 576.3333333333334 | 732.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 2_110 | 552.3333333333334 | 708.0 | Compositional bias | Note=Ser-rich | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 2_110 | 576.3333333333334 | 732.0 | Compositional bias | Note=Ser-rich | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 109_113 | 552.3333333333334 | 708.0 | Motif | Note=Nuclear localization signal 1 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 195_206 | 552.3333333333334 | 708.0 | Motif | Note=Nuclear localization signal 2 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 235_245 | 552.3333333333334 | 708.0 | Motif | Nuclear export signal | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 109_113 | 576.3333333333334 | 732.0 | Motif | Note=Nuclear localization signal 1 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 195_206 | 576.3333333333334 | 732.0 | Motif | Note=Nuclear localization signal 2 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 235_245 | 576.3333333333334 | 732.0 | Motif | Nuclear export signal | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 419_458 | 552.3333333333334 | 708.0 | Repeat | Note=WD 1 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 468_508 | 552.3333333333334 | 708.0 | Repeat | Note=WD 2 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 511_551 | 552.3333333333334 | 708.0 | Repeat | Note=WD 3 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 419_458 | 576.3333333333334 | 732.0 | Repeat | Note=WD 1 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 468_508 | 576.3333333333334 | 732.0 | Repeat | Note=WD 2 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 511_551 | 576.3333333333334 | 732.0 | Repeat | Note=WD 3 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 553_593 | 576.3333333333334 | 732.0 | Repeat | Note=WD 4 | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000308769 | 13 | 19 | 136_174 | 552.3333333333334 | 708.0 | Zinc finger | RING-type | |
Tgene | RFWD2 | chr1:164532548 | chr1:175958615 | ENST00000367669 | 14 | 20 | 136_174 | 576.3333333333334 | 732.0 | Zinc finger | RING-type |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
Gene | STRING network |
PBX1 | |
RFWD2 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to PBX1-RFWD2 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to PBX1-RFWD2 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | PBX1 | C0006413 | Burkitt Lymphoma | 2 | CTD_human;ORPHANET |
Hgene | PBX1 | C0343640 | African Burkitt's lymphoma | 2 | CTD_human |
Hgene | PBX1 | C1968949 | Cakut | 2 | GENOMICS_ENGLAND |
Hgene | PBX1 | C4721444 | Burkitt Leukemia | 2 | CTD_human |
Hgene | PBX1 | C0013146 | Drug abuse | 1 | CTD_human |
Hgene | PBX1 | C0013170 | Drug habituation | 1 | CTD_human |
Hgene | PBX1 | C0013222 | Drug Use Disorders | 1 | CTD_human |
Hgene | PBX1 | C0029231 | Organic Mental Disorders, Substance-Induced | 1 | CTD_human |
Hgene | PBX1 | C0038580 | Substance Dependence | 1 | CTD_human |
Hgene | PBX1 | C0038586 | Substance Use Disorders | 1 | CTD_human |
Hgene | PBX1 | C0236969 | Substance-Related Disorders | 1 | CTD_human |
Hgene | PBX1 | C0431692 | Bilateral renal hypoplasia | 1 | ORPHANET |
Hgene | PBX1 | C0740858 | Substance abuse problem | 1 | CTD_human |
Hgene | PBX1 | C1510472 | Drug Dependence | 1 | CTD_human |
Hgene | PBX1 | C4316881 | Prescription Drug Abuse | 1 | CTD_human |
Hgene | PBX1 | C4539968 | CONGENITAL ANOMALIES OF KIDNEY AND URINARY TRACT SYNDROME WITH OR WITHOUT HEARING LOSS, ABNORMAL EARS, OR DEVELOPMENTAL DELAY | 1 | GENOMICS_ENGLAND |