UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:PLA2G2A-MBTPS1 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: PLA2G2A-MBTPS1 | FusionPDB ID: 65858 | FusionGDB2.0 ID: 65858 | Hgene | Tgene | Gene symbol | PLA2G2A | MBTPS1 | Gene ID | 5320 | 8720 |
Gene name | phospholipase A2 group IIA | membrane bound transcription factor peptidase, site 1 | |
Synonyms | MOM1|PLA2|PLA2B|PLA2L|PLA2S|PLAS1|sPLA2 | PCSK8|S1P|SEDKF|SKI-1 | |
Cytomap | 1p36.13 | 16q23.3-q24.1 | |
Type of gene | protein-coding | protein-coding | |
Description | phospholipase A2, membrane associatedGIIC sPLA2NPS-PLA2group IIA phospholipase A2non-pancreatic secretory phospholipase A2phosphatidylcholine 2-acylhydrolase 2Aphospholipase A2, group IIA (platelets, synovial fluid) | membrane-bound transcription factor site-1 proteaseendopeptidase S1Pproprotein convertase subtilisin/kexin type 8site-1 proteasesubtilisin/kexin isozyme-1 | |
Modification date | 20200322 | 20200313 | |
UniProtAcc | . | Q14703 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000375111, ENST00000496748, ENST00000400520, | ENST00000569770, ENST00000343411, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 7 X 3 X 2=42 | 3 X 3 X 2=18 |
# samples | 7 | 3 | |
** MAII score | log2(7/42*10)=0.736965594166206 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(3/18*10)=0.736965594166206 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: PLA2G2A [Title/Abstract] AND MBTPS1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | PLA2G2A(20301931)-MBTPS1(84103643), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | PLA2G2A-MBTPS1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. PLA2G2A-MBTPS1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. PLA2G2A-MBTPS1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. PLA2G2A-MBTPS1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. PLA2G2A-MBTPS1 seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. PLA2G2A-MBTPS1 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. PLA2G2A-MBTPS1 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. PLA2G2A-MBTPS1 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | PLA2G2A | GO:0006644 | phospholipid metabolic process | 17069818 |
Hgene | PLA2G2A | GO:0046473 | phosphatidic acid metabolic process | 9032461 |
Hgene | PLA2G2A | GO:0070374 | positive regulation of ERK1 and ERK2 cascade | 22837859 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | PRAD | TCGA-G9-7525-01A | PLA2G2A | chr1 | 20301931 | - | MBTPS1 | chr16 | 84103643 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000496748 | PLA2G2A | chr1 | 20301931 | - | ENST00000343411 | MBTPS1 | chr16 | 84103643 | - | 3366 | 1306 | 1264 | 2682 | 472 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000496748 | ENST00000343411 | PLA2G2A | chr1 | 20301931 | - | MBTPS1 | chr16 | 84103643 | - | 0.003963079 | 0.99603695 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >65858_65858_1_PLA2G2A-MBTPS1_PLA2G2A_chr1_20301931_ENST00000496748_MBTPS1_chr16_84103643_ENST00000343411_length(amino acids)=472AA_BP=14 MYSGGSLLNKAISKSKNGAEQTSTVKLPIKVKIIPTPPRSKRVLWDQYHNLRYPPGYFPRDNLRMKNDPLDWNGDHIHTNFRDMYQHLRS MGYFVEVLGAPFTCFDASQYGTLLMVDSEEEYFPEEIAKLRRDVDNGLSLVIFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNE LLSVWNMGFSDGLYEGEFTLANHDMYYASGCSIAKFPEDGVVITQTFKDQGLEVLKQETAVVENVPILGLYQIPAEGGGRIVLYGDSNCL DDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPSGAGSVTPERMEGNHLHRYSKVLEAHLGDPKPRPLPACPRLSWAKPQPLNE TAPSNLWKHQKLLSIDLDKVVLPNFRSNRPQVRPLSPGESGAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVVLAFFVVQINKAKSRPKR -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:20301931/chr16:84103643) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | MBTPS1 |
FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Serine protease that cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4: known substrates are SREBF1/SREBP1, SREBF2/SREBP2, BDNF, GNPTAB, ATF6 and ATF6B (PubMed:10644685, PubMed:12782636, PubMed:21719679). Cleaves substrates after Arg-Ser-Val-Leu (SREBP2), Arg-His-Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu (PubMed:10644685, PubMed:21719679). Catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs) SREBF1/SREBP1 and SREBF2/SREBP2 (PubMed:12782636). Also mediates the first step in the proteolytic activation of the cyclic AMP-dependent transcription factor ATF-6 (ATF6 and ATF6B) (PubMed:12782636). Mediates the protein cleavage of GNPTAB into subunit alpha and beta, thereby participating in biogenesis of lysosomes (PubMed:21719679). Involved in the regulation of M6P-dependent Golgi-to-lysosome trafficking of lysosomal enzymes (PubMed:21719679, PubMed:30046013). It is required for the activation of CREB3L2/BBF2H7, a transcriptional activator of MIA3/TANGO and other genes controlling mega vesicle formation (PubMed:30046013). Therefore, it plays a key role in the regulation of mega vesicle-mediated collagen trafficking (PubMed:30046013). {ECO:0000269|PubMed:10644685, ECO:0000269|PubMed:12782636, ECO:0000269|PubMed:21719679, ECO:0000269|PubMed:30046013}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | MBTPS1 | chr1:20301931 | chr16:84103643 | ENST00000343411 | 12 | 23 | 1023_1050 | 594.0 | 1053.0 | Compositional bias | Note=Arg/Lys/Pro-rich (basic) | |
Tgene | MBTPS1 | chr1:20301931 | chr16:84103643 | ENST00000343411 | 12 | 23 | 1022_1052 | 594.0 | 1053.0 | Topological domain | Cytoplasmic | |
Tgene | MBTPS1 | chr1:20301931 | chr16:84103643 | ENST00000343411 | 12 | 23 | 999_1021 | 594.0 | 1053.0 | Transmembrane | Helical |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | MBTPS1 | chr1:20301931 | chr16:84103643 | ENST00000343411 | 12 | 23 | 190_472 | 594.0 | 1053.0 | Domain | Peptidase S8 | |
Tgene | MBTPS1 | chr1:20301931 | chr16:84103643 | ENST00000343411 | 12 | 23 | 187_998 | 594.0 | 1053.0 | Topological domain | Lumenal |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
PLA2G2A | |
MBTPS1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to PLA2G2A-MBTPS1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to PLA2G2A-MBTPS1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |