UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:RHOA-EMC3 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: RHOA-EMC3 | FusionPDB ID: 73925 | FusionGDB2.0 ID: 73940 | Hgene | Tgene | Gene symbol | RHOA | EMC3 | Gene ID | 387 | 55831 |
Gene name | ras homolog family member A | ER membrane protein complex subunit 3 | |
Synonyms | ARH12|ARHA|EDFAOB|RHO12|RHOH12 | POB|TMEM111 | |
Cytomap | 3p21.31 | 3p25.3 | |
Type of gene | protein-coding | protein-coding | |
Description | transforming protein RhoAAplysia ras-related homolog 12epididymis secretory sperm binding proteinoncogene RHO H12small GTP binding protein RhoA | ER membrane protein complex subunit 330 kDa proteinpartial optokinetic response btransmembrane protein 111 | |
Modification date | 20200329 | 20200313 | |
UniProtAcc | . | Q9P0I2 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000418115, ENST00000422781, ENST00000265538, ENST00000454011, | ENST00000497557, ENST00000429759, ENST00000245046, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 24 X 14 X 11=3696 | 6 X 7 X 5=210 |
# samples | 24 | 8 | |
** MAII score | log2(24/3696*10)=-3.94485844580754 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(8/210*10)=-1.39231742277876 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: RHOA [Title/Abstract] AND EMC3 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | EMC3(10012266)-RHOA(49400059), # samples:2 RHOA(49405861)-EMC3(10011485), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | EMC3-RHOA seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. EMC3-RHOA seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. RHOA-EMC3 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. RHOA-EMC3 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. RHOA-EMC3 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. RHOA-EMC3 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | RHOA | GO:0007266 | Rho protein signal transduction | 26529257 |
Hgene | RHOA | GO:0016477 | cell migration | 26529257 |
Hgene | RHOA | GO:0032956 | regulation of actin cytoskeleton organization | 25911094 |
Hgene | RHOA | GO:0035385 | Roundabout signaling pathway | 26529257 |
Hgene | RHOA | GO:0036089 | cleavage furrow formation | 16103226 |
Hgene | RHOA | GO:0051496 | positive regulation of stress fiber assembly | 15467718 |
Hgene | RHOA | GO:0060193 | positive regulation of lipase activity | 19887681 |
Hgene | RHOA | GO:0071222 | cellular response to lipopolysaccharide | 19734146 |
Hgene | RHOA | GO:0071902 | positive regulation of protein serine/threonine kinase activity | 8617235 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | READ | TCGA-EI-6510-01A | RHOA | chr3 | 49405861 | - | EMC3 | chr3 | 10011485 | - |
ChimerDB4 | READ | TCGA-EI-6510 | RHOA | chr3 | 49405861 | - | EMC3 | chr3 | 10011485 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000418115 | RHOA | chr3 | 49405861 | - | ENST00000245046 | EMC3 | chr3 | 10011485 | - | 2406 | 662 | 385 | 873 | 162 |
ENST00000422781 | RHOA | chr3 | 49405861 | - | ENST00000245046 | EMC3 | chr3 | 10011485 | - | 2174 | 430 | 153 | 641 | 162 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000418115 | ENST00000245046 | RHOA | chr3 | 49405861 | - | EMC3 | chr3 | 10011485 | - | 0.005496888 | 0.99450314 |
ENST00000422781 | ENST00000245046 | RHOA | chr3 | 49405861 | - | EMC3 | chr3 | 10011485 | - | 0.004463604 | 0.99553645 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >73925_73925_1_RHOA-EMC3_RHOA_chr3_49405861_ENST00000418115_EMC3_chr3_10011485_ENST00000245046_length(amino acids)=162AA_BP=92 MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPD -------------------------------------------------------------- >73925_73925_2_RHOA-EMC3_RHOA_chr3_49405861_ENST00000422781_EMC3_chr3_10011485_ENST00000245046_length(amino acids)=162AA_BP=92 MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPD -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr3:10012266/chr3:49400059) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | EMC3 |
FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins (PubMed:30415835, PubMed:29809151, PubMed:29242231, PubMed:32459176, PubMed:32439656). Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues (PubMed:30415835, PubMed:29809151, PubMed:29242231). Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices (PubMed:30415835, PubMed:29809151). It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes (PubMed:29809151, PubMed:29242231). By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors (PubMed:30415835). By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (Probable). {ECO:0000269|PubMed:29242231, ECO:0000269|PubMed:29809151, ECO:0000269|PubMed:30415835, ECO:0000269|PubMed:32439656, ECO:0000269|PubMed:32459176, ECO:0000305}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | RHOA | chr3:49405861 | chr3:10011485 | ENST00000418115 | - | 3 | 5 | 34_42 | 92.33333333333333 | 194.0 | Motif | Effector region |
Hgene | RHOA | chr3:49405861 | chr3:10011485 | ENST00000418115 | - | 3 | 5 | 12_19 | 92.33333333333333 | 194.0 | Nucleotide binding | GTP |
Hgene | RHOA | chr3:49405861 | chr3:10011485 | ENST00000418115 | - | 3 | 5 | 59_63 | 92.33333333333333 | 194.0 | Nucleotide binding | GTP |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | RHOA | chr3:49405861 | chr3:10011485 | ENST00000418115 | - | 3 | 5 | 182_187 | 92.33333333333333 | 194.0 | Compositional bias | Note=Arg/Lys-rich (basic) |
Hgene | RHOA | chr3:49405861 | chr3:10011485 | ENST00000418115 | - | 3 | 5 | 117_120 | 92.33333333333333 | 194.0 | Nucleotide binding | GTP |
Tgene | EMC3 | chr3:49405861 | chr3:10011485 | ENST00000245046 | 5 | 8 | 131_168 | 191.33333333333334 | 262.0 | Topological domain | Lumenal | |
Tgene | EMC3 | chr3:49405861 | chr3:10011485 | ENST00000245046 | 5 | 8 | 188_261 | 191.33333333333334 | 262.0 | Topological domain | Cytoplasmic | |
Tgene | EMC3 | chr3:49405861 | chr3:10011485 | ENST00000245046 | 5 | 8 | 2_14 | 191.33333333333334 | 262.0 | Topological domain | Lumenal | |
Tgene | EMC3 | chr3:49405861 | chr3:10011485 | ENST00000245046 | 5 | 8 | 39_114 | 191.33333333333334 | 262.0 | Topological domain | Cytoplasmic | |
Tgene | EMC3 | chr3:49405861 | chr3:10011485 | ENST00000245046 | 5 | 8 | 115_130 | 191.33333333333334 | 262.0 | Transmembrane | Helical | |
Tgene | EMC3 | chr3:49405861 | chr3:10011485 | ENST00000245046 | 5 | 8 | 15_38 | 191.33333333333334 | 262.0 | Transmembrane | Helical | |
Tgene | EMC3 | chr3:49405861 | chr3:10011485 | ENST00000245046 | 5 | 8 | 169_187 | 191.33333333333334 | 262.0 | Transmembrane | Helical |
Top |
Fusion Protein Structures |
![]() * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
PDB file >>>153_RHOA_49405861_EMC3_10011485_ranked_0.pdb | RHOA | 49405861 | 49405861 | ENST00000245046 | EMC3 | chr3 | 10011485 | - | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPD | 162 |
Top |
pLDDT score distribution |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
RHOA_pLDDT.png![]() |
EMC3_pLDDT.png![]() |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
![]() |
Top |
Ramachandran Plot of Fusion Protein Structure |
![]() |
Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
RHOA | |
EMC3 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to RHOA-EMC3 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to RHOA-EMC3 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |