| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:STAT3-KAT2A |
Fusion Protein Summary |
Fusion gene summary |
| Fusion partner gene information | Fusion gene name: STAT3-KAT2A | FusionPDB ID: 87242 | FusionGDB2.0 ID: 87242 | Hgene | Tgene | Gene symbol | STAT3 | KAT2A | Gene ID | 6774 | 2648 |
| Gene name | signal transducer and activator of transcription 3 | lysine acetyltransferase 2A | |
| Synonyms | ADMIO|ADMIO1|APRF|HIES | GCN5|GCN5L2|PCAF-b|hGCN5 | |
| Cytomap | 17q21.2 | 17q21.2 | |
| Type of gene | protein-coding | protein-coding | |
| Description | signal transducer and activator of transcription 3DNA-binding protein APRFacute-phase response factor | histone acetyltransferase KAT2AGCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2General control of amino acid synthesis, yeast, homolog-like 2K(lysine) acetyltransferase 2ASTAF97general control of amino acid synthesis protein 5-li | |
| Modification date | 20200329 | 20200313 | |
| UniProtAcc | . | Q92830 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000264657, ENST00000404395, ENST00000585517, ENST00000588969, ENST00000389272, ENST00000590776, | ENST00000225916, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 18 X 20 X 10=3600 | 2 X 2 X 2=8 |
| # samples | 23 | 2 | |
| ** MAII score | log2(23/3600*10)=-3.96829114027266 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(2/8*10)=1.32192809488736 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: STAT3 [Title/Abstract] AND KAT2A [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | STAT3(40500407)-KAT2A(40272847), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | STAT3-KAT2A seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. STAT3-KAT2A seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. STAT3-KAT2A seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. STAT3-KAT2A seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. STAT3-KAT2A seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. STAT3-KAT2A seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. STAT3-KAT2A seems lost the major protein functional domain in Hgene partner, which is a transcription factor due to the frame-shifted ORF. STAT3-KAT2A seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. STAT3-KAT2A seems lost the major protein functional domain in Tgene partner, which is a epigenetic factor due to the frame-shifted ORF. STAT3-KAT2A seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. STAT3-KAT2A seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | STAT3 | GO:0006355 | regulation of transcription, DNA-templated | 15664994|17344214 |
| Hgene | STAT3 | GO:0006606 | protein import into nucleus | 18234692 |
| Hgene | STAT3 | GO:0010507 | negative regulation of autophagy | 26962683 |
| Hgene | STAT3 | GO:0010628 | positive regulation of gene expression | 23820254 |
| Hgene | STAT3 | GO:0030522 | intracellular receptor signaling pathway | 17324931 |
| Hgene | STAT3 | GO:0032355 | response to estradiol | 12552091 |
| Hgene | STAT3 | GO:0032870 | cellular response to hormone stimulus | 12552091 |
| Hgene | STAT3 | GO:0033210 | leptin-mediated signaling pathway | 17344214 |
| Hgene | STAT3 | GO:0035278 | miRNA mediated inhibition of translation | 23820254 |
| Hgene | STAT3 | GO:0044320 | cellular response to leptin stimulus | 17344214 |
| Hgene | STAT3 | GO:0044321 | response to leptin | 17344214 |
| Hgene | STAT3 | GO:0045893 | positive regulation of transcription, DNA-templated | 19390056 |
| Hgene | STAT3 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 17324931|27050391|31462771 |
| Hgene | STAT3 | GO:0051726 | regulation of cell cycle | 17344214 |
| Hgene | STAT3 | GO:0060396 | growth hormone receptor signaling pathway | 10925297 |
| Hgene | STAT3 | GO:0060397 | JAK-STAT cascade involved in growth hormone signaling pathway | 12552091 |
| Hgene | STAT3 | GO:0070102 | interleukin-6-mediated signaling pathway | 12359225|12552091|17324931|24429361 |
| Hgene | STAT3 | GO:1902895 | positive regulation of pri-miRNA transcription by RNA polymerase II | 19390056|23820254 |
| Hgene | STAT3 | GO:2000637 | positive regulation of gene silencing by miRNA | 23820254 |
| Tgene | KAT2A | GO:0016573 | histone acetylation | 29973595|31527837 |
| Tgene | KAT2A | GO:0016578 | histone deubiquitination | 18206972 |
| Tgene | KAT2A | GO:0018393 | internal peptidyl-lysine acetylation | 27796307|29174768 |
| Tgene | KAT2A | GO:0043966 | histone H3 acetylation | 10373431|11564863|18838386|29211711 |
| Tgene | KAT2A | GO:0045893 | positive regulation of transcription, DNA-templated | 29973595|31527837 |
| Tgene | KAT2A | GO:0045944 | positive regulation of transcription by RNA polymerase II | 29211711 |
| Tgene | KAT2A | GO:0046600 | negative regulation of centriole replication | 27796307 |
| Tgene | KAT2A | GO:0106077 | histone succinylation | 29211711 |
Fusion gene breakpoints across STAT3 (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Fusion gene breakpoints across KAT2A (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | CESC | TCGA-VS-A9UP-01A | STAT3 | chr17 | 40500407 | - | KAT2A | chr17 | 40272847 | - |
| ChimerDB4 | CESC | TCGA-VS-A9UP | STAT3 | chr17 | 40500407 | - | KAT2A | chr17 | 40272847 | - |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000585517 | STAT3 | chr17 | 40500407 | - | ENST00000225916 | KAT2A | chr17 | 40272847 | - | 3009 | 293 | 290 | 2467 | 725 |
| ENST00000588969 | STAT3 | chr17 | 40500407 | - | ENST00000225916 | KAT2A | chr17 | 40272847 | - | 3049 | 333 | 330 | 2507 | 725 |
| ENST00000404395 | STAT3 | chr17 | 40500407 | - | ENST00000225916 | KAT2A | chr17 | 40272847 | - | 2981 | 265 | 262 | 2439 | 725 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000585517 | ENST00000225916 | STAT3 | chr17 | 40500407 | - | KAT2A | chr17 | 40272847 | - | 0.006216389 | 0.9937836 |
| ENST00000588969 | ENST00000225916 | STAT3 | chr17 | 40500407 | - | KAT2A | chr17 | 40272847 | - | 0.005969398 | 0.99403054 |
| ENST00000404395 | ENST00000225916 | STAT3 | chr17 | 40500407 | - | KAT2A | chr17 | 40272847 | - | 0.00548166 | 0.99451834 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >87242_87242_1_STAT3-KAT2A_STAT3_chr17_40500407_ENST00000404395_KAT2A_chr17_40272847_ENST00000225916_length(amino acids)=725AA_BP=1 MANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLF KLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNY TRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMP PSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAM LGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGG ICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLME CELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLA QIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEG -------------------------------------------------------------- >87242_87242_2_STAT3-KAT2A_STAT3_chr17_40500407_ENST00000585517_KAT2A_chr17_40272847_ENST00000225916_length(amino acids)=725AA_BP=1 MANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLF KLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNY TRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMP PSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAM LGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGG ICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLME CELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLA QIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEG -------------------------------------------------------------- >87242_87242_3_STAT3-KAT2A_STAT3_chr17_40500407_ENST00000588969_KAT2A_chr17_40272847_ENST00000225916_length(amino acids)=725AA_BP=1 MANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLF KLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNY TRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMP PSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAM LGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGG ICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLME CELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLA QIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEG -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genesGo to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr17:40500407/chr17:40272847) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| . | KAT2A |
| FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Protein lysine acyltransferase that can act as a acetyltransferase, glutaryltransferase or succinyltransferase, depending on the context (PubMed:29211711). Acts as a histone lysine succinyltransferase: catalyzes succinylation of histone H3 on 'Lys-79' (H3K79succ), with a maximum frequency around the transcription start sites of genes (PubMed:29211711). Succinylation of histones gives a specific tag for epigenetic transcription activation (PubMed:29211711). Association with the 2-oxoglutarate dehydrogenase complex, which provides succinyl-CoA, is required for histone succinylation (PubMed:29211711). In different complexes, functions either as an acetyltransferase (HAT) or as a succinyltransferase: in the SAGA and ATAC complexes, acts as a histone acetyltransferase (PubMed:17301242, PubMed:19103755, PubMed:29211711). Has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles (PubMed:17301242, PubMed:19103755). Acetylation of histones gives a specific tag for epigenetic transcription activation (PubMed:17301242, PubMed:19103755, PubMed:29211711). Recruited by the XPC complex at promoters, where it specifically mediates acetylation of histone variant H2A.Z.1/H2A.Z, thereby promoting expression of target genes (PubMed:29973595, PubMed:31527837). Involved in long-term memory consolidation and synaptic plasticity: acts by promoting expression of a hippocampal gene expression network linked to neuroactive receptor signaling (By similarity). Acts as a positive regulator of T-cell activation: upon TCR stimulation, recruited to the IL2 promoter following interaction with NFATC2 and catalyzes acetylation of histone H3 at 'Lys-9' (H3K9ac), leading to promote IL2 expression (By similarity). Required for growth and differentiation of craniofacial cartilage and bone by regulating acetylation of histone H3 at 'Lys-9' (H3K9ac) (By similarity). Regulates embryonic stem cell (ESC) pluripotency and differentiation (By similarity). Also acetylates non-histone proteins, such as CEBPB, PLK4 and TBX5 (PubMed:17301242, PubMed:27796307, PubMed:29174768). Involved in heart and limb development by mediating acetylation of TBX5, acetylation regulating nucleocytoplasmic shuttling of TBX5 (PubMed:29174768). Acts as a negative regulator of centrosome amplification by mediating acetylation of PLK4 (PubMed:27796307). Also acts as a histone glutaryltransferase: catalyzes glutarylation of histone H4 on 'Lys-91' (H4K91glu), a mark that destabilizes nucleosomes by promoting dissociation of the H2A-H2B dimers from nucleosomes (PubMed:31542297). {ECO:0000250|UniProtKB:Q9JHD2, ECO:0000269|PubMed:17301242, ECO:0000269|PubMed:19103755, ECO:0000269|PubMed:27796307, ECO:0000269|PubMed:29174768, ECO:0000269|PubMed:29211711, ECO:0000269|PubMed:29973595, ECO:0000269|PubMed:31527837, ECO:0000269|PubMed:31542297}.; FUNCTION: (Microbial infection) In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes. {ECO:0000269|PubMed:11384967}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | KAT2A | chr17:40500407 | chr17:40272847 | ENST00000225916 | 0 | 18 | 503_656 | 113.0 | 838.0 | Domain | N-acetyltransferase | |
| Tgene | KAT2A | chr17:40500407 | chr17:40272847 | ENST00000225916 | 0 | 18 | 745_815 | 113.0 | 838.0 | Domain | Bromo | |
| Tgene | KAT2A | chr17:40500407 | chr17:40272847 | ENST00000225916 | 0 | 18 | 579_581 | 113.0 | 838.0 | Region | Acetyl-CoA and acyl-CoA binding | |
| Tgene | KAT2A | chr17:40500407 | chr17:40272847 | ENST00000225916 | 0 | 18 | 586_592 | 113.0 | 838.0 | Region | Acetyl-CoA and acyl-CoA binding | |
| Tgene | KAT2A | chr17:40500407 | chr17:40272847 | ENST00000225916 | 0 | 18 | 617_620 | 113.0 | 838.0 | Region | Acetyl-CoA and acyl-CoA binding | |
| Tgene | KAT2A | chr17:40500407 | chr17:40272847 | ENST00000225916 | 0 | 18 | 639_648 | 113.0 | 838.0 | Region | Loop 3 |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | STAT3 | chr17:40500407 | chr17:40272847 | ENST00000264657 | - | 2 | 24 | 580_670 | 42.666666666666664 | 771.0 | Domain | SH2 |
| Hgene | STAT3 | chr17:40500407 | chr17:40272847 | ENST00000404395 | - | 2 | 24 | 580_670 | 42.666666666666664 | 770.0 | Domain | SH2 |
| Hgene | STAT3 | chr17:40500407 | chr17:40272847 | ENST00000588969 | - | 2 | 24 | 580_670 | 42.666666666666664 | 771.0 | Domain | SH2 |
| Hgene | STAT3 | chr17:40500407 | chr17:40272847 | ENST00000264657 | - | 2 | 24 | 150_162 | 42.666666666666664 | 771.0 | Motif | Note=Essential for nuclear import |
| Hgene | STAT3 | chr17:40500407 | chr17:40272847 | ENST00000404395 | - | 2 | 24 | 150_162 | 42.666666666666664 | 770.0 | Motif | Note=Essential for nuclear import |
| Hgene | STAT3 | chr17:40500407 | chr17:40272847 | ENST00000588969 | - | 2 | 24 | 150_162 | 42.666666666666664 | 771.0 | Motif | Note=Essential for nuclear import |
Top |
Fusion Protein Structures |
PDB and CIF files of the predicted fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
| PDB file >>>1473_STAT3_40500407_KAT2A_40272847_ranked_0.pdb | STAT3 | 40500407 | 40500407 | ENST00000225916 | KAT2A | chr17 | 40272847 | - | MANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLF KLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNY TRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMP PSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAM LGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGG ICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLME CELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLA QIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEG | 725 |
Top |
pLDDT score distribution |
pLDDT score distribution of the predicted wild-type structures of two partner proteins from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
STAT3_pLDDT.png![]() |
KAT2A_pLDDT.png![]() |
pLDDT score distribution of the predicted fusion protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
![]() |
Top |
Ramachandran Plot of Fusion Protein Structure |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| STAT3 | |
| KAT2A |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to STAT3-KAT2A |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to STAT3-KAT2A |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |