UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:BBS1-DDB2 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: BBS1-DDB2 | FusionPDB ID: 9085 | FusionGDB2.0 ID: 9085 | Hgene | Tgene | Gene symbol | BBS1 | DDB2 | Gene ID | 582 | 1643 |
Gene name | Bardet-Biedl syndrome 1 | damage specific DNA binding protein 2 | |
Synonyms | BBS2L2 | DDBB|UV-DDB2|XPE | |
Cytomap | 11q13.2 | 11p11.2 | |
Type of gene | protein-coding | protein-coding | |
Description | Bardet-Biedl syndrome 1 proteinBBS2-like protein 2 | DNA damage-binding protein 2DDB p48 subunitUV-DDB 2UV-damaged DNA-binding protein 2damage-specific DNA binding protein 2, 48kDaxeroderma pigmentosum group E protein | |
Modification date | 20200320 | 20200327 | |
UniProtAcc | Q6ZW61 | Q92466 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000529766, ENST00000318312, ENST00000455748, ENST00000393994, ENST00000537537, | ENST00000256996, ENST00000378600, ENST00000378603, ENST00000378601, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 2 X 2 X 2=8 | 12 X 6 X 7=504 |
# samples | 2 | 11 | |
** MAII score | log2(2/8*10)=1.32192809488736 | log2(11/504*10)=-2.19592020997526 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: BBS1 [Title/Abstract] AND DDB2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | BBS1(66291353)-DDB2(47259387), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | BBS1-DDB2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. BBS1-DDB2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. BBS1-DDB2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. BBS1-DDB2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | DDB2 | GO:0000209 | protein polyubiquitination | 12732143 |
Tgene | DDB2 | GO:0009411 | response to UV | 12732143 |
Tgene | DDB2 | GO:0035518 | histone H2A monoubiquitination | 22334663 |
Tgene | DDB2 | GO:0051865 | protein autoubiquitination | 12732143 |
Tgene | DDB2 | GO:0070914 | UV-damage excision repair | 22334663 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | OV | TCGA-36-1570 | BBS1 | chr11 | 66291353 | + | DDB2 | chr11 | 47259387 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000318312 | BBS1 | chr11 | 66291353 | + | ENST00000378600 | DDB2 | chr11 | 47259387 | + | 1789 | 1161 | 51 | 1421 | 456 |
ENST00000318312 | BBS1 | chr11 | 66291353 | + | ENST00000378603 | DDB2 | chr11 | 47259387 | + | 1789 | 1161 | 51 | 1421 | 456 |
ENST00000318312 | BBS1 | chr11 | 66291353 | + | ENST00000256996 | DDB2 | chr11 | 47259387 | + | 1789 | 1161 | 51 | 1421 | 456 |
ENST00000455748 | BBS1 | chr11 | 66291353 | + | ENST00000378600 | DDB2 | chr11 | 47259387 | + | 1465 | 837 | 18 | 1097 | 359 |
ENST00000455748 | BBS1 | chr11 | 66291353 | + | ENST00000378603 | DDB2 | chr11 | 47259387 | + | 1465 | 837 | 18 | 1097 | 359 |
ENST00000455748 | BBS1 | chr11 | 66291353 | + | ENST00000256996 | DDB2 | chr11 | 47259387 | + | 1465 | 837 | 18 | 1097 | 359 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000318312 | ENST00000378600 | BBS1 | chr11 | 66291353 | + | DDB2 | chr11 | 47259387 | + | 0.005339256 | 0.9946608 |
ENST00000318312 | ENST00000378603 | BBS1 | chr11 | 66291353 | + | DDB2 | chr11 | 47259387 | + | 0.005339256 | 0.9946608 |
ENST00000318312 | ENST00000256996 | BBS1 | chr11 | 66291353 | + | DDB2 | chr11 | 47259387 | + | 0.005339256 | 0.9946608 |
ENST00000455748 | ENST00000378600 | BBS1 | chr11 | 66291353 | + | DDB2 | chr11 | 47259387 | + | 0.004150922 | 0.995849 |
ENST00000455748 | ENST00000378603 | BBS1 | chr11 | 66291353 | + | DDB2 | chr11 | 47259387 | + | 0.004150922 | 0.995849 |
ENST00000455748 | ENST00000256996 | BBS1 | chr11 | 66291353 | + | DDB2 | chr11 | 47259387 | + | 0.004150922 | 0.995849 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >9085_9085_1_BBS1-DDB2_BBS1_chr11_66291353_ENST00000318312_DDB2_chr11_47259387_ENST00000256996_length(amino acids)=456AA_BP=370 MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAA TFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELS EMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNG NIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRD KALLNVIHTPAAWHPRYNLIVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQE -------------------------------------------------------------- >9085_9085_2_BBS1-DDB2_BBS1_chr11_66291353_ENST00000318312_DDB2_chr11_47259387_ENST00000378600_length(amino acids)=456AA_BP=370 MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAA TFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELS EMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNG NIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRD KALLNVIHTPAAWHPRYNLIVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQE -------------------------------------------------------------- >9085_9085_3_BBS1-DDB2_BBS1_chr11_66291353_ENST00000318312_DDB2_chr11_47259387_ENST00000378603_length(amino acids)=456AA_BP=370 MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAA TFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELS EMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNG NIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRD KALLNVIHTPAAWHPRYNLIVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQE -------------------------------------------------------------- >9085_9085_4_BBS1-DDB2_BBS1_chr11_66291353_ENST00000455748_DDB2_chr11_47259387_ENST00000256996_length(amino acids)=359AA_BP=273 MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAA TFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRR DSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVI -------------------------------------------------------------- >9085_9085_5_BBS1-DDB2_BBS1_chr11_66291353_ENST00000455748_DDB2_chr11_47259387_ENST00000378600_length(amino acids)=359AA_BP=273 MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAA TFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRR DSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVI -------------------------------------------------------------- >9085_9085_6_BBS1-DDB2_BBS1_chr11_66291353_ENST00000455748_DDB2_chr11_47259387_ENST00000378603_length(amino acids)=359AA_BP=273 MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAA TFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRR DSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVI -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr11:66291353/chr11:47259387) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
BBS1 | DDB2 |
FUNCTION: Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of proteins upon ATP hydrolysis. As part of the TRiC complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia (PubMed:20080638). Involved in adipogenic differentiation (PubMed:19190184). {ECO:0000269|PubMed:19190184, ECO:0000269|PubMed:20080638}. | FUNCTION: Protein, which is both involved in DNA repair and protein ubiquitination, as part of the UV-DDB complex and DCX (DDB1-CUL4-X-box) complexes, respectively (PubMed:10882109, PubMed:11278856, PubMed:11705987, PubMed:9892649, PubMed:12732143, PubMed:15882621, PubMed:16473935, PubMed:18593899). Core component of the UV-DDB complex (UV-damaged DNA-binding protein complex), a complex that recognizes UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair (PubMed:10882109, PubMed:11278856, PubMed:11705987, PubMed:16260596, PubMed:12944386, PubMed:14751237). The UV-DDB complex preferentially binds to cyclobutane pyrimidine dimers (CPD), 6-4 photoproducts (6-4 PP), apurinic sites and short mismatches (PubMed:10882109, PubMed:11278856, PubMed:11705987, PubMed:16260596, PubMed:12944386). Also functions as the substrate recognition module for the DCX (DDB2-CUL4-X-box) E3 ubiquitin-protein ligase complex DDB2-CUL4-ROC1 (also known as CUL4-DDB-ROC1 and CUL4-DDB-RBX1) (PubMed:12732143, PubMed:15882621, PubMed:16473935, PubMed:18593899, PubMed:26572825). The DDB2-CUL4-ROC1 complex may ubiquitinate histone H2A, histone H3 and histone H4 at sites of UV-induced DNA damage (PubMed:16678110, PubMed:16473935). The ubiquitination of histones may facilitate their removal from the nucleosome and promote subsequent DNA repair (PubMed:16678110, PubMed:16473935). The DDB2-CUL4-ROC1 complex also ubiquitinates XPC, which may enhance DNA-binding by XPC and promote NER (PubMed:15882621). The DDB2-CUL4-ROC1 complex also ubiquitinates KAT7/HBO1 in response to DNA damage, leading to its degradation: recognizes KAT7/HBO1 following phosphorylation by ATR (PubMed:26572825). {ECO:0000269|PubMed:10882109, ECO:0000269|PubMed:11278856, ECO:0000269|PubMed:11705987, ECO:0000269|PubMed:12732143, ECO:0000269|PubMed:12944386, ECO:0000269|PubMed:14751237, ECO:0000269|PubMed:15882621, ECO:0000269|PubMed:16260596, ECO:0000269|PubMed:16473935, ECO:0000269|PubMed:16678110, ECO:0000269|PubMed:18593899, ECO:0000269|PubMed:26572825, ECO:0000269|PubMed:9892649}.; FUNCTION: [Isoform D1]: Inhibits UV-damaged DNA repair. {ECO:0000269|PubMed:14751237}.; FUNCTION: [Isoform D2]: Inhibits UV-damaged DNA repair. {ECO:0000269|PubMed:14751237}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378600 | 2 | 6 | 256_274 | 152.0 | 239.0 | Motif | Note=DWD box | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378600 | 2 | 6 | 334_336 | 152.0 | 239.0 | Region | Note=Photolesion recognition | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378601 | 5 | 9 | 334_336 | 281.6666666666667 | 237.33333333333334 | Region | Note=Photolesion recognition | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378603 | 5 | 9 | 334_336 | 277.0 | 364.0 | Region | Note=Photolesion recognition | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000256996 | 6 | 10 | 343_386 | 341.0 | 428.0 | Repeat | WD 6 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000256996 | 6 | 10 | 396_420 | 341.0 | 428.0 | Repeat | WD 7 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378600 | 2 | 6 | 159_194 | 152.0 | 239.0 | Repeat | WD 2 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378600 | 2 | 6 | 203_238 | 152.0 | 239.0 | Repeat | WD 3 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378600 | 2 | 6 | 244_287 | 152.0 | 239.0 | Repeat | WD 4 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378600 | 2 | 6 | 290_329 | 152.0 | 239.0 | Repeat | WD 5 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378600 | 2 | 6 | 343_386 | 152.0 | 239.0 | Repeat | WD 6 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378600 | 2 | 6 | 396_420 | 152.0 | 239.0 | Repeat | WD 7 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378601 | 5 | 9 | 290_329 | 281.6666666666667 | 237.33333333333334 | Repeat | WD 5 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378601 | 5 | 9 | 343_386 | 281.6666666666667 | 237.33333333333334 | Repeat | WD 6 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378601 | 5 | 9 | 396_420 | 281.6666666666667 | 237.33333333333334 | Repeat | WD 7 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378603 | 5 | 9 | 290_329 | 277.0 | 364.0 | Repeat | WD 5 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378603 | 5 | 9 | 343_386 | 277.0 | 364.0 | Repeat | WD 6 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378603 | 5 | 9 | 396_420 | 277.0 | 364.0 | Repeat | WD 7 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000256996 | 6 | 10 | 256_274 | 341.0 | 428.0 | Motif | Note=DWD box | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378601 | 5 | 9 | 256_274 | 281.6666666666667 | 237.33333333333334 | Motif | Note=DWD box | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378603 | 5 | 9 | 256_274 | 277.0 | 364.0 | Motif | Note=DWD box | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000256996 | 6 | 10 | 334_336 | 341.0 | 428.0 | Region | Note=Photolesion recognition | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000256996 | 6 | 10 | 116_151 | 341.0 | 428.0 | Repeat | WD 1 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000256996 | 6 | 10 | 159_194 | 341.0 | 428.0 | Repeat | WD 2 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000256996 | 6 | 10 | 203_238 | 341.0 | 428.0 | Repeat | WD 3 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000256996 | 6 | 10 | 244_287 | 341.0 | 428.0 | Repeat | WD 4 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000256996 | 6 | 10 | 290_329 | 341.0 | 428.0 | Repeat | WD 5 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378600 | 2 | 6 | 116_151 | 152.0 | 239.0 | Repeat | WD 1 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378601 | 5 | 9 | 116_151 | 281.6666666666667 | 237.33333333333334 | Repeat | WD 1 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378601 | 5 | 9 | 159_194 | 281.6666666666667 | 237.33333333333334 | Repeat | WD 2 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378601 | 5 | 9 | 203_238 | 281.6666666666667 | 237.33333333333334 | Repeat | WD 3 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378601 | 5 | 9 | 244_287 | 281.6666666666667 | 237.33333333333334 | Repeat | WD 4 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378603 | 5 | 9 | 116_151 | 277.0 | 364.0 | Repeat | WD 1 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378603 | 5 | 9 | 159_194 | 277.0 | 364.0 | Repeat | WD 2 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378603 | 5 | 9 | 203_238 | 277.0 | 364.0 | Repeat | WD 3 | |
Tgene | DDB2 | chr11:66291353 | chr11:47259387 | ENST00000378603 | 5 | 9 | 244_287 | 277.0 | 364.0 | Repeat | WD 4 |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
BBS1 | |
DDB2 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to BBS1-DDB2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to BBS1-DDB2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |