UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:BBS4-CSNK1G1 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: BBS4-CSNK1G1 | FusionPDB ID: 9093 | FusionGDB2.0 ID: 9093 | Hgene | Tgene | Gene symbol | BBS4 | CSNK1G1 | Gene ID | 585 | 53944 |
Gene name | Bardet-Biedl syndrome 4 | casein kinase 1 gamma 1 | |
Synonyms | - | CK1gamma1 | |
Cytomap | 15q24.1 | 15q22.31 | |
Type of gene | protein-coding | protein-coding | |
Description | Bardet-Biedl syndrome 4 protein | casein kinase I isoform gamma-1 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q96RK4 | Q9HCP0 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000268057, ENST00000395205, ENST00000539603, ENST00000542334, ENST00000564239, | ENST00000303032, ENST00000303052, ENST00000607537, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 5 X 6 X 3=90 | 9 X 10 X 8=720 |
# samples | 5 | 9 | |
** MAII score | log2(5/90*10)=-0.84799690655495 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/720*10)=-3 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: BBS4 [Title/Abstract] AND CSNK1G1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | BBS4(73028307)-CSNK1G1(64472653), # samples:5 | ||
Anticipated loss of major functional domain due to fusion event. | BBS4-CSNK1G1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. BBS4-CSNK1G1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. BBS4-CSNK1G1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. BBS4-CSNK1G1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | CSNK1G1 | GO:0018105 | peptidyl-serine phosphorylation | 25500533 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | PRAD | TCGA-M7-A725-01A | BBS4 | chr15 | 73028307 | - | CSNK1G1 | chr15 | 64472653 | - |
ChimerDB4 | PRAD | TCGA-M7-A725-01A | BBS4 | chr15 | 73028307 | + | CSNK1G1 | chr15 | 64472653 | - |
ChimerDB4 | PRAD | TCGA-M7-A725-01A | BBS4 | chr15 | 73030680 | + | CSNK1G1 | chr15 | 64480228 | - |
ChimerDB4 | PRAD | TCGA-M7-A725 | BBS4 | chr15 | 73028307 | + | CSNK1G1 | chr15 | 64472653 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000542334 | BBS4 | chr15 | 73028307 | + | ENST00000303052 | CSNK1G1 | chr15 | 64472653 | - | 7819 | 1243 | 436 | 1404 | 322 |
ENST00000542334 | BBS4 | chr15 | 73028307 | + | ENST00000607537 | CSNK1G1 | chr15 | 64472653 | - | 1697 | 1243 | 436 | 1452 | 338 |
ENST00000268057 | BBS4 | chr15 | 73028307 | + | ENST00000303052 | CSNK1G1 | chr15 | 64472653 | - | 7865 | 1289 | 41 | 1450 | 469 |
ENST00000268057 | BBS4 | chr15 | 73028307 | + | ENST00000607537 | CSNK1G1 | chr15 | 64472653 | - | 1743 | 1289 | 41 | 1498 | 485 |
ENST00000539603 | BBS4 | chr15 | 73028307 | + | ENST00000303052 | CSNK1G1 | chr15 | 64472653 | - | 7903 | 1327 | 115 | 1488 | 457 |
ENST00000539603 | BBS4 | chr15 | 73028307 | + | ENST00000607537 | CSNK1G1 | chr15 | 64472653 | - | 1781 | 1327 | 115 | 1536 | 473 |
ENST00000395205 | BBS4 | chr15 | 73028307 | + | ENST00000303052 | CSNK1G1 | chr15 | 64472653 | - | 7848 | 1272 | 0 | 1433 | 477 |
ENST00000395205 | BBS4 | chr15 | 73028307 | + | ENST00000607537 | CSNK1G1 | chr15 | 64472653 | - | 1726 | 1272 | 0 | 1481 | 493 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000542334 | ENST00000303052 | BBS4 | chr15 | 73028307 | + | CSNK1G1 | chr15 | 64472653 | - | 0.000897734 | 0.99910223 |
ENST00000542334 | ENST00000607537 | BBS4 | chr15 | 73028307 | + | CSNK1G1 | chr15 | 64472653 | - | 0.002184853 | 0.99781513 |
ENST00000268057 | ENST00000303052 | BBS4 | chr15 | 73028307 | + | CSNK1G1 | chr15 | 64472653 | - | 0.000331089 | 0.99966896 |
ENST00000268057 | ENST00000607537 | BBS4 | chr15 | 73028307 | + | CSNK1G1 | chr15 | 64472653 | - | 0.00196018 | 0.9980399 |
ENST00000539603 | ENST00000303052 | BBS4 | chr15 | 73028307 | + | CSNK1G1 | chr15 | 64472653 | - | 0.001086942 | 0.99891305 |
ENST00000539603 | ENST00000607537 | BBS4 | chr15 | 73028307 | + | CSNK1G1 | chr15 | 64472653 | - | 0.00645809 | 0.99354184 |
ENST00000395205 | ENST00000303052 | BBS4 | chr15 | 73028307 | + | CSNK1G1 | chr15 | 64472653 | - | 0.000620151 | 0.9993799 |
ENST00000395205 | ENST00000607537 | BBS4 | chr15 | 73028307 | + | CSNK1G1 | chr15 | 64472653 | - | 0.003459949 | 0.99654007 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >9093_9093_1_BBS4-CSNK1G1_BBS4_chr15_73028307_ENST00000268057_CSNK1G1_chr15_64472653_ENST00000303052_length(amino acids)=469AA_BP=416 MAEERVATRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELF QTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLL EGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESP PLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRA YAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEE -------------------------------------------------------------- >9093_9093_2_BBS4-CSNK1G1_BBS4_chr15_73028307_ENST00000268057_CSNK1G1_chr15_64472653_ENST00000607537_length(amino acids)=485AA_BP=416 MAEERVATRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELF QTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLL EGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESP PLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRA YAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEE -------------------------------------------------------------- >9093_9093_3_BBS4-CSNK1G1_BBS4_chr15_73028307_ENST00000395205_CSNK1G1_chr15_64472653_ENST00000303052_length(amino acids)=477AA_BP=424 MALTVVPSFSVSGVWKRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGN IQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYI MLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVV ACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLE DIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEVVSSTNGELNVDDPTGAHSNAPITAH -------------------------------------------------------------- >9093_9093_4_BBS4-CSNK1G1_BBS4_chr15_73028307_ENST00000395205_CSNK1G1_chr15_64472653_ENST00000607537_length(amino acids)=493AA_BP=424 MALTVVPSFSVSGVWKRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGN IQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYI MLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVV ACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLE DIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEVVSSTNGELNVDDPTGAHSNAPITAH -------------------------------------------------------------- >9093_9093_5_BBS4-CSNK1G1_BBS4_chr15_73028307_ENST00000539603_CSNK1G1_chr15_64472653_ENST00000303052_length(amino acids)=457AA_BP=404 MIWNTRNSTYIFTAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQSAD NLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYK KAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFG KKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNP LVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRK -------------------------------------------------------------- >9093_9093_6_BBS4-CSNK1G1_BBS4_chr15_73028307_ENST00000539603_CSNK1G1_chr15_64472653_ENST00000607537_length(amino acids)=473AA_BP=404 MIWNTRNSTYIFTAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQSAD NLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYK KAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFG KKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNP LVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCIMFHKPWHW -------------------------------------------------------------- >9093_9093_7_BBS4-CSNK1G1_BBS4_chr15_73028307_ENST00000542334_CSNK1G1_chr15_64472653_ENST00000303052_length(amino acids)=322AA_BP=269 MKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYK AILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFL SAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEV -------------------------------------------------------------- >9093_9093_8_BBS4-CSNK1G1_BBS4_chr15_73028307_ENST00000542334_CSNK1G1_chr15_64472653_ENST00000607537_length(amino acids)=338AA_BP=269 MKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYK AILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFL SAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEV -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr15:73028307/chr15:64472653) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
BBS4 | CSNK1G1 |
FUNCTION: The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane. The BBSome complex, together with the LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation. Required for proper BBSome complex assembly and its ciliary localization. Required for microtubule anchoring at the centrosome but not for microtubule nucleation. May be required for the dynein-mediated transport of pericentriolar proteins to the centrosome. {ECO:0000269|PubMed:15107855, ECO:0000269|PubMed:17574030, ECO:0000269|PubMed:22072986}. | FUNCTION: Serine/threonine-protein kinase. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Regulates fast synaptic transmission mediated by glutamate (By similarity). Phosphorylates CLSPN. {ECO:0000250, ECO:0000269|PubMed:21680713}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000268057 | + | 14 | 16 | 1_66 | 416.0 | 520.0 | Region | Note=Required for localization to centrosomes |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000395205 | + | 14 | 16 | 1_66 | 424.0 | 528.0 | Region | Note=Required for localization to centrosomes |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 1_66 | 244.0 | 348.0 | Region | Note=Required for localization to centrosomes |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000268057 | + | 14 | 16 | 101_134 | 416.0 | 520.0 | Repeat | Note=TPR 2 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000268057 | + | 14 | 16 | 135_168 | 416.0 | 520.0 | Repeat | Note=TPR 3 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000268057 | + | 14 | 16 | 169_201 | 416.0 | 520.0 | Repeat | Note=TPR 4 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000268057 | + | 14 | 16 | 203_235 | 416.0 | 520.0 | Repeat | Note=TPR 5 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000268057 | + | 14 | 16 | 237_269 | 416.0 | 520.0 | Repeat | Note=TPR 6 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000268057 | + | 14 | 16 | 270_303 | 416.0 | 520.0 | Repeat | Note=TPR 7 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000268057 | + | 14 | 16 | 304_337 | 416.0 | 520.0 | Repeat | Note=TPR 8 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000268057 | + | 14 | 16 | 339_371 | 416.0 | 520.0 | Repeat | Note=TPR 9 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000268057 | + | 14 | 16 | 373_408 | 416.0 | 520.0 | Repeat | Note=TPR 10 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000268057 | + | 14 | 16 | 67_100 | 416.0 | 520.0 | Repeat | Note=TPR 1 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000395205 | + | 14 | 16 | 101_134 | 424.0 | 528.0 | Repeat | Note=TPR 2 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000395205 | + | 14 | 16 | 135_168 | 424.0 | 528.0 | Repeat | Note=TPR 3 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000395205 | + | 14 | 16 | 169_201 | 424.0 | 528.0 | Repeat | Note=TPR 4 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000395205 | + | 14 | 16 | 203_235 | 424.0 | 528.0 | Repeat | Note=TPR 5 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000395205 | + | 14 | 16 | 237_269 | 424.0 | 528.0 | Repeat | Note=TPR 6 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000395205 | + | 14 | 16 | 270_303 | 424.0 | 528.0 | Repeat | Note=TPR 7 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000395205 | + | 14 | 16 | 304_337 | 424.0 | 528.0 | Repeat | Note=TPR 8 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000395205 | + | 14 | 16 | 339_371 | 424.0 | 528.0 | Repeat | Note=TPR 9 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000395205 | + | 14 | 16 | 373_408 | 424.0 | 528.0 | Repeat | Note=TPR 10 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000395205 | + | 14 | 16 | 67_100 | 424.0 | 528.0 | Repeat | Note=TPR 1 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 101_134 | 244.0 | 348.0 | Repeat | Note=TPR 2 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 135_168 | 244.0 | 348.0 | Repeat | Note=TPR 3 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 169_201 | 244.0 | 348.0 | Repeat | Note=TPR 4 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 203_235 | 244.0 | 348.0 | Repeat | Note=TPR 5 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 67_100 | 244.0 | 348.0 | Repeat | Note=TPR 1 |
Tgene | CSNK1G1 | chr15:73028307 | chr15:64472653 | ENST00000303032 | 0 | 11 | 44_315 | 0 | 394.0 | Domain | Protein kinase | |
Tgene | CSNK1G1 | chr15:73028307 | chr15:64472653 | ENST00000303032 | 0 | 11 | 50_58 | 0 | 394.0 | Nucleotide binding | ATP |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000268057 | + | 14 | 16 | 338_519 | 416.0 | 520.0 | Region | Note=Required for localization to centrosomes |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000395205 | + | 14 | 16 | 338_519 | 424.0 | 528.0 | Region | Note=Required for localization to centrosomes |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 338_519 | 244.0 | 348.0 | Region | Note=Required for localization to centrosomes |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 237_269 | 244.0 | 348.0 | Repeat | Note=TPR 6 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 270_303 | 244.0 | 348.0 | Repeat | Note=TPR 7 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 304_337 | 244.0 | 348.0 | Repeat | Note=TPR 8 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 339_371 | 244.0 | 348.0 | Repeat | Note=TPR 9 |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 373_408 | 244.0 | 348.0 | Repeat | Note=TPR 10 |
Tgene | CSNK1G1 | chr15:73028307 | chr15:64472653 | ENST00000303052 | 9 | 12 | 44_315 | 369.0 | 423.0 | Domain | Protein kinase | |
Tgene | CSNK1G1 | chr15:73028307 | chr15:64472653 | ENST00000303052 | 9 | 12 | 50_58 | 369.0 | 423.0 | Nucleotide binding | ATP |
Top |
Fusion Protein Structures |
![]() * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
PDB file >>>1039_BBS4_73028307_CSNK1G1_64472653_1039_BBS4_73028307_CSNK1G1_64472653_ranked_0.pdb | BBS4 | 73028307 | 73028307 | ENST00000607537 | CSNK1G1 | chr15 | 64472653 | - | MALTVVPSFSVSGVWKRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGN IQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYI MLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVV ACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLE DIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEVVSSTNGELNVDDPTGAHSNAPITAH | 493 |
Top |
pLDDT score distribution |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
BBS4_pLDDT.png![]() |
CSNK1G1_pLDDT.png![]() |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
![]() |
Top |
Ramachandran Plot of Fusion Protein Structure |
![]() |
Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
BBS4 | |
CSNK1G1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Hgene | BBS4 | chr15:73028307 | chr15:64472653 | ENST00000542334 | + | 13 | 15 | 101_337 | 244.0 | 348.0 | PCM1 |
Top |
Related Drugs to BBS4-CSNK1G1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to BBS4-CSNK1G1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |