| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:TPM2-MYH9 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: TPM2-MYH9 | FusionPDB ID: 93364 | FusionGDB2.0 ID: 93364 | Hgene | Tgene | Gene symbol | TPM2 | MYH9 | Gene ID | 7169 | 4627 |
| Gene name | tropomyosin 2 | myosin heavy chain 9 | |
| Synonyms | AMCD1|DA1|DA2B|DA2B4|HEL-S-273|NEM4|TMSB | BDPLT6|DFNA17|EPSTS|FTNS|MATINS|MHA|NMHC-II-A|NMMHC-IIA|NMMHCA | |
| Cytomap | 9p13.3 | 22q12.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | tropomyosin beta chainepididymis secretory protein Li 273nemaline myopathy type 4tropomyosin 2 (beta) | myosin-9cellular myosin heavy chain, type Amyosin, heavy chain 9, non-musclenon-muscle myosin heavy chain 9non-muscle myosin heavy chain Anon-muscle myosin heavy chain IIanon-muscle myosin heavy polypeptide 9nonmuscle myosin heavy chain II-A | |
| Modification date | 20200328 | 20200315 | |
| UniProtAcc | . | P35579 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000329305, ENST00000360958, ENST00000378292, ENST00000378300, | ENST00000401701, ENST00000475726, ENST00000216181, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 19 X 15 X 5=1425 | 44 X 46 X 15=30360 |
| # samples | 21 | 56 | |
| ** MAII score | log2(21/1425*10)=-2.76250068627334 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(56/30360*10)=-5.76060115335786 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: TPM2 [Title/Abstract] AND MYH9 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | TPM2(35689701)-MYH9(36696223), # samples:1 TPM2(35689768)-MYH9(36695090), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | TPM2-MYH9 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. TPM2-MYH9 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | TPM2 | GO:0043462 | regulation of ATPase activity | 17194691 |
| Tgene | MYH9 | GO:0001525 | angiogenesis | 16403913 |
| Tgene | MYH9 | GO:0001778 | plasma membrane repair | 27325790 |
| Tgene | MYH9 | GO:0006509 | membrane protein ectodomain proteolysis | 16186248 |
| Tgene | MYH9 | GO:0030048 | actin filament-based movement | 12237319|15845534 |
| Tgene | MYH9 | GO:0031032 | actomyosin structure organization | 24072716 |
| Fusion gene breakpoints across TPM2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across MYH9 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | SARC | TCGA-K1-A6RT-01A | TPM2 | chr9 | 35689701 | - | MYH9 | chr22 | 36696223 | - |
| ChiTaRS5.0 | N/A | BF840453 | TPM2 | chr9 | 35689768 | - | MYH9 | chr22 | 36695090 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000378300 | TPM2 | chr9 | 35689701 | - | ENST00000216181 | MYH9 | chr22 | 36696223 | - | 4545 | 200 | 2415 | 3851 | 478 |
| ENST00000378292 | TPM2 | chr9 | 35689701 | - | ENST00000216181 | MYH9 | chr22 | 36696223 | - | 5662 | 1317 | 3532 | 4968 | 478 |
| ENST00000329305 | TPM2 | chr9 | 35689701 | - | ENST00000216181 | MYH9 | chr22 | 36696223 | - | 4555 | 210 | 2425 | 3861 | 478 |
| ENST00000360958 | TPM2 | chr9 | 35689701 | - | ENST00000216181 | MYH9 | chr22 | 36696223 | - | 4564 | 219 | 2434 | 3870 | 478 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000378300 | ENST00000216181 | TPM2 | chr9 | 35689701 | - | MYH9 | chr22 | 36696223 | - | 0.002354014 | 0.99764603 |
| ENST00000378292 | ENST00000216181 | TPM2 | chr9 | 35689701 | - | MYH9 | chr22 | 36696223 | - | 0.002598547 | 0.9974015 |
| ENST00000329305 | ENST00000216181 | TPM2 | chr9 | 35689701 | - | MYH9 | chr22 | 36696223 | - | 0.002293203 | 0.9977068 |
| ENST00000360958 | ENST00000216181 | TPM2 | chr9 | 35689701 | - | MYH9 | chr22 | 36696223 | - | 0.00227195 | 0.99772805 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >93364_93364_1_TPM2-MYH9_TPM2_chr9_35689701_ENST00000329305_MYH9_chr22_36696223_ENST00000216181_length(amino acids)=478AA_BP= MKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQ LRKLQVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQLLAEEKTISAKYAE ERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLS QRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHN LEKQIATLHAQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQL -------------------------------------------------------------- >93364_93364_2_TPM2-MYH9_TPM2_chr9_35689701_ENST00000360958_MYH9_chr22_36696223_ENST00000216181_length(amino acids)=478AA_BP= MKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQ LRKLQVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQLLAEEKTISAKYAE ERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLS QRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHN LEKQIATLHAQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQL -------------------------------------------------------------- >93364_93364_3_TPM2-MYH9_TPM2_chr9_35689701_ENST00000378292_MYH9_chr22_36696223_ENST00000216181_length(amino acids)=478AA_BP= MKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQ LRKLQVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQLLAEEKTISAKYAE ERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLS QRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHN LEKQIATLHAQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQL -------------------------------------------------------------- >93364_93364_4_TPM2-MYH9_TPM2_chr9_35689701_ENST00000378300_MYH9_chr22_36696223_ENST00000216181_length(amino acids)=478AA_BP= MKDCMRELDDTRASREEILAQAKENEKKLKSMEAEMIQLQEVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQ LRKLQVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQLLAEEKTISAKYAE ERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLS QRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHN LEKQIATLHAQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQL -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:35689701/chr22:36696223) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| . | MYH9 |
| FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. Promotes also cell motility together with S100A4 (PubMed:16707441). During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10 (PubMed:20052411). {ECO:0000250|UniProtKB:Q8VDD5, ECO:0000269|PubMed:16707441, ECO:0000269|PubMed:20052411}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | MYH9 | chr9:35689701 | chr22:36696223 | ENST00000216181 | 0 | 41 | 837_1926 | 0 | 1961.0 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | MYH9 | chr9:35689701 | chr22:36696223 | ENST00000216181 | 0 | 41 | 27_77 | 0 | 1961.0 | Domain | Myosin N-terminal SH3-like | |
| Tgene | MYH9 | chr9:35689701 | chr22:36696223 | ENST00000216181 | 0 | 41 | 779_808 | 0 | 1961.0 | Domain | IQ | |
| Tgene | MYH9 | chr9:35689701 | chr22:36696223 | ENST00000216181 | 0 | 41 | 81_776 | 0 | 1961.0 | Domain | Myosin motor | |
| Tgene | MYH9 | chr9:35689701 | chr22:36696223 | ENST00000216181 | 0 | 41 | 174_181 | 0 | 1961.0 | Nucleotide binding | ATP | |
| Tgene | MYH9 | chr9:35689701 | chr22:36696223 | ENST00000216181 | 0 | 41 | 654_676 | 0 | 1961.0 | Region | Note=Actin-binding |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | TPM2 | chr9:35689701 | chr22:36696223 | ENST00000360958 | - | 1 | 9 | 1_284 | 38.0 | 285.0 | Coiled coil | Ontology_term=ECO:0000250 |
| Hgene | TPM2 | chr9:35689701 | chr22:36696223 | ENST00000378292 | - | 1 | 9 | 1_284 | 38.0 | 285.0 | Coiled coil | Ontology_term=ECO:0000250 |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| TPM2 | |
| MYH9 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to TPM2-MYH9 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to TPM2-MYH9 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies