| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:WASF2-FGR |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: WASF2-FGR | FusionPDB ID: 98726 | FusionGDB2.0 ID: 98726 | Hgene | Tgene | Gene symbol | WASF2 | FGR | Gene ID | 10163 | 2268 |
| Gene name | WASP family member 2 | FGR proto-oncogene, Src family tyrosine kinase | |
| Synonyms | IMD2|SCAR2|WASF4|WAVE2|dJ393P12.2 | SRC2|c-fgr|c-src2|p55-Fgr|p55c-fgr|p58-Fgr|p58c-fgr | |
| Cytomap | 1p36.11 | 1p35.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | wiskott-Aldrich syndrome protein family member 2WAS protein family member 2WASP family Verprolin-homologous protein 2WASP family protein member 2WASP family protein member 4protein WAVE-2putative Wiskott-Aldrich syndrome protein family member 4supp | tyrosine-protein kinase FgrGardner-Rasheed feline sarcoma viral (v-fgr) oncogene homologc-fgr protooncogenec-src-2 proto-oncogenefeline Gardner-Rasheed sarcoma viral oncogene homologp55-c-fgr proteinproto-oncogene c-Fgrproto-oncogene tyrosine-prote | |
| Modification date | 20200313 | 20200329 | |
| UniProtAcc | . | P09769 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000430629, ENST00000536657, | ENST00000468038, ENST00000374005, ENST00000399173, ENST00000545953, ENST00000374004, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 11 X 7 X 10=770 | 6 X 7 X 6=252 |
| # samples | 23 | 10 | |
| ** MAII score | log2(23/770*10)=-1.74322458463789 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(10/252*10)=-1.33342373372519 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: WASF2 [Title/Abstract] AND FGR [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | WASF2(27816497)-FGR(27951662), # samples:15 | ||
| Anticipated loss of major functional domain due to fusion event. | WASF2-FGR seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. WASF2-FGR seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | FGR | GO:0018108 | peptidyl-tyrosine phosphorylation | 7519620|8327512 |
| Tgene | FGR | GO:0046777 | protein autophosphorylation | 2181286|8327512 |
| Fusion gene breakpoints across WASF2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across FGR (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BRCA | TCGA-BH-A1FD-01A | WASF2 | chr1 | 27755271 | - | FGR | chr1 | 27939861 | - |
| ChimerDB4 | ESCA | TCGA-L5-A891-01A | WASF2 | chr1 | 27816497 | - | FGR | chr1 | 27951662 | - |
| ChimerDB4 | ESCA | TCGA-L5-A891 | WASF2 | chr1 | 27816496 | - | FGR | chr1 | 27951662 | - |
| ChimerDB4 | ESCA | TCGA-L5-A891 | WASF2 | chr1 | 27816497 | - | FGR | chr1 | 27951662 | - |
| ChimerDB4 | ESCA | TCGA-L5-A891 | WASF2 | chr1 | 27816497 | - | FGR | chr1 | 27967635 | - |
| ChimerDB4 | LUSC | TCGA-66-2759-01A | WASF2 | chr1 | 27816497 | - | FGR | chr1 | 27951662 | - |
| ChimerDB4 | LUSC | TCGA-66-2759 | WASF2 | chr1 | 27816497 | - | FGR | chr1 | 27951662 | - |
| ChimerDB4 | LUSC | TCGA-66-2759 | WASF2 | chr1 | 27816497 | - | FGR | chr1 | 27967635 | - |
| ChimerDB4 | OV | TCGA-13-0893-01B | WASF2 | chr1 | 27816497 | - | FGR | chr1 | 27951662 | - |
| ChimerDB4 | OV | TCGA-23-2078-01A | WASF2 | chr1 | 27816497 | - | FGR | chr1 | 27951662 | - |
| ChimerDB4 | OV | TCGA-23-2078 | WASF2 | chr1 | 27816496 | - | FGR | chr1 | 27951662 | - |
| ChimerDB4 | SKCM | TCGA-ER-A19W-06A | WASF2 | chr1 | 27816497 | - | FGR | chr1 | 27951662 | - |
| ChimerDB4 | SKCM | TCGA-ER-A19W-06A | WASF2 | chr1 | 27816497 | - | FGR | chr1 | 27967635 | - |
| ChimerDB4 | UCS | TCGA-NA-A4R1-01A | WASF2 | chr1 | 27816494 | - | FGR | chr1 | 27951659 | - |
| ChimerDB4 | UCS | TCGA-NA-A4R1-01A | WASF2 | chr1 | 27816497 | - | FGR | chr1 | 27951662 | - |
| ChimerDB4 | UCS | TCGA-NA-A4R1 | WASF2 | chr1 | 27816496 | - | FGR | chr1 | 27951662 | - |
| ChimerDB4 | UCS | TCGA-NA-A4R1 | WASF2 | chr1 | 27816497 | - | FGR | chr1 | 27951662 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000430629 | WASF2 | chr1 | 27755271 | - | ENST00000374005 | FGR | chr1 | 27939861 | - | 1537 | 346 | 216 | 686 | 156 |
| ENST00000430629 | WASF2 | chr1 | 27755271 | - | ENST00000399173 | FGR | chr1 | 27939861 | - | 1309 | 346 | 216 | 686 | 156 |
| ENST00000430629 | WASF2 | chr1 | 27755271 | - | ENST00000545953 | FGR | chr1 | 27939861 | - | 1309 | 346 | 216 | 686 | 156 |
| ENST00000430629 | WASF2 | chr1 | 27755271 | - | ENST00000374004 | FGR | chr1 | 27939861 | - | 1301 | 346 | 216 | 686 | 156 |
| ENST00000536657 | WASF2 | chr1 | 27755271 | - | ENST00000374005 | FGR | chr1 | 27939861 | - | 1430 | 239 | 109 | 579 | 156 |
| ENST00000536657 | WASF2 | chr1 | 27755271 | - | ENST00000399173 | FGR | chr1 | 27939861 | - | 1202 | 239 | 109 | 579 | 156 |
| ENST00000536657 | WASF2 | chr1 | 27755271 | - | ENST00000545953 | FGR | chr1 | 27939861 | - | 1202 | 239 | 109 | 579 | 156 |
| ENST00000536657 | WASF2 | chr1 | 27755271 | - | ENST00000374004 | FGR | chr1 | 27939861 | - | 1194 | 239 | 109 | 579 | 156 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000430629 | ENST00000374005 | WASF2 | chr1 | 27755271 | - | FGR | chr1 | 27939861 | - | 0.023485249 | 0.9765147 |
| ENST00000430629 | ENST00000399173 | WASF2 | chr1 | 27755271 | - | FGR | chr1 | 27939861 | - | 0.028049778 | 0.97195023 |
| ENST00000430629 | ENST00000545953 | WASF2 | chr1 | 27755271 | - | FGR | chr1 | 27939861 | - | 0.028049778 | 0.97195023 |
| ENST00000430629 | ENST00000374004 | WASF2 | chr1 | 27755271 | - | FGR | chr1 | 27939861 | - | 0.029997561 | 0.9700024 |
| ENST00000536657 | ENST00000374005 | WASF2 | chr1 | 27755271 | - | FGR | chr1 | 27939861 | - | 0.043958884 | 0.95604116 |
| ENST00000536657 | ENST00000399173 | WASF2 | chr1 | 27755271 | - | FGR | chr1 | 27939861 | - | 0.03566935 | 0.9643306 |
| ENST00000536657 | ENST00000545953 | WASF2 | chr1 | 27755271 | - | FGR | chr1 | 27939861 | - | 0.03566935 | 0.9643306 |
| ENST00000536657 | ENST00000374004 | WASF2 | chr1 | 27755271 | - | FGR | chr1 | 27939861 | - | 0.039102618 | 0.9608974 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >98726_98726_1_WASF2-FGR_WASF2_chr1_27755271_ENST00000430629_FGR_chr1_27939861_ENST00000374004_length(amino acids)=156AA_BP=37 MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN -------------------------------------------------------------- >98726_98726_2_WASF2-FGR_WASF2_chr1_27755271_ENST00000430629_FGR_chr1_27939861_ENST00000374005_length(amino acids)=156AA_BP=37 MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN -------------------------------------------------------------- >98726_98726_3_WASF2-FGR_WASF2_chr1_27755271_ENST00000430629_FGR_chr1_27939861_ENST00000399173_length(amino acids)=156AA_BP=37 MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN -------------------------------------------------------------- >98726_98726_4_WASF2-FGR_WASF2_chr1_27755271_ENST00000430629_FGR_chr1_27939861_ENST00000545953_length(amino acids)=156AA_BP=37 MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN -------------------------------------------------------------- >98726_98726_5_WASF2-FGR_WASF2_chr1_27755271_ENST00000536657_FGR_chr1_27939861_ENST00000374004_length(amino acids)=156AA_BP=37 MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN -------------------------------------------------------------- >98726_98726_6_WASF2-FGR_WASF2_chr1_27755271_ENST00000536657_FGR_chr1_27939861_ENST00000374005_length(amino acids)=156AA_BP=37 MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN -------------------------------------------------------------- >98726_98726_7_WASF2-FGR_WASF2_chr1_27755271_ENST00000536657_FGR_chr1_27939861_ENST00000399173_length(amino acids)=156AA_BP=37 MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN -------------------------------------------------------------- >98726_98726_8_WASF2-FGR_WASF2_chr1_27755271_ENST00000536657_FGR_chr1_27939861_ENST00000545953_length(amino acids)=156AA_BP=37 MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:27816497/chr1:27951662) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| . | FGR |
| FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Non-receptor tyrosine-protein kinase that transmits signals from cell surface receptors devoid of kinase activity and contributes to the regulation of immune responses, including neutrophil, monocyte, macrophage and mast cell functions, cytoskeleton remodeling in response to extracellular stimuli, phagocytosis, cell adhesion and migration. Promotes mast cell degranulation, release of inflammatory cytokines and IgE-mediated anaphylaxis. Acts downstream of receptors that bind the Fc region of immunoglobulins, such as MS4A2/FCER1B, FCGR2A and/or FCGR2B. Acts downstream of ITGB1 and ITGB2, and regulates actin cytoskeleton reorganization, cell spreading and adhesion. Depending on the context, activates or inhibits cellular responses. Functions as negative regulator of ITGB2 signaling, phagocytosis and SYK activity in monocytes. Required for normal ITGB1 and ITGB2 signaling, normal cell spreading and adhesion in neutrophils and macrophages. Functions as positive regulator of cell migration and regulates cytoskeleton reorganization via RAC1 activation. Phosphorylates SYK (in vitro) and promotes SYK-dependent activation of AKT1 and MAP kinase signaling. Phosphorylates PLD2 in antigen-stimulated mast cells, leading to PLD2 activation and the production of the signaling molecules lysophosphatidic acid and diacylglycerol. Promotes activation of PIK3R1. Phosphorylates FASLG, and thereby regulates its ubiquitination and subsequent internalization. Phosphorylates ABL1. Promotes phosphorylation of CBL, CTTN, PIK3R1, PTK2/FAK1, PTK2B/PYK2 and VAV2. Phosphorylates HCLS1 that has already been phosphorylated by SYK, but not unphosphorylated HCLS1. Together with CLNK, it acts as a negative regulator of natural killer cell-activating receptors and inhibits interferon-gamma production (By similarity). {ECO:0000250|UniProtKB:P14234, ECO:0000269|PubMed:10739672, ECO:0000269|PubMed:17164290, ECO:0000269|PubMed:1737799, ECO:0000269|PubMed:7519620}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000430629 | - | 2 | 9 | 268_271 | 43.333333333333336 | 499.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000430629 | - | 2 | 9 | 318_328 | 43.333333333333336 | 499.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000430629 | - | 2 | 9 | 333_338 | 43.333333333333336 | 499.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000430629 | - | 2 | 9 | 347_350 | 43.333333333333336 | 499.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000430629 | - | 2 | 9 | 364_371 | 43.333333333333336 | 499.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000430629 | - | 2 | 9 | 379_382 | 43.333333333333336 | 499.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000430629 | - | 2 | 9 | 391_406 | 43.333333333333336 | 499.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000536657 | - | 2 | 8 | 268_271 | 43.333333333333336 | 282.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000536657 | - | 2 | 8 | 318_328 | 43.333333333333336 | 282.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000536657 | - | 2 | 8 | 333_338 | 43.333333333333336 | 282.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000536657 | - | 2 | 8 | 347_350 | 43.333333333333336 | 282.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000536657 | - | 2 | 8 | 364_371 | 43.333333333333336 | 282.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000536657 | - | 2 | 8 | 379_382 | 43.333333333333336 | 282.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000536657 | - | 2 | 8 | 391_406 | 43.333333333333336 | 282.0 | Compositional bias | Note=Poly-Pro |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000430629 | - | 2 | 9 | 436_453 | 43.333333333333336 | 499.0 | Domain | WH2 |
| Hgene | WASF2 | chr1:27755271 | chr1:27939861 | ENST00000536657 | - | 2 | 8 | 436_453 | 43.333333333333336 | 282.0 | Domain | WH2 |
| Tgene | FGR | chr1:27755271 | chr1:27939861 | ENST00000374004 | 8 | 11 | 144_241 | 416.3333333333333 | 530.0 | Domain | SH2 | |
| Tgene | FGR | chr1:27755271 | chr1:27939861 | ENST00000374004 | 8 | 11 | 263_516 | 416.3333333333333 | 530.0 | Domain | Protein kinase | |
| Tgene | FGR | chr1:27755271 | chr1:27939861 | ENST00000374004 | 8 | 11 | 77_138 | 416.3333333333333 | 530.0 | Domain | SH3 | |
| Tgene | FGR | chr1:27755271 | chr1:27939861 | ENST00000374005 | 10 | 13 | 144_241 | 416.3333333333333 | 530.0 | Domain | SH2 | |
| Tgene | FGR | chr1:27755271 | chr1:27939861 | ENST00000374005 | 10 | 13 | 263_516 | 416.3333333333333 | 530.0 | Domain | Protein kinase | |
| Tgene | FGR | chr1:27755271 | chr1:27939861 | ENST00000374005 | 10 | 13 | 77_138 | 416.3333333333333 | 530.0 | Domain | SH3 | |
| Tgene | FGR | chr1:27755271 | chr1:27939861 | ENST00000399173 | 10 | 13 | 144_241 | 416.3333333333333 | 530.0 | Domain | SH2 | |
| Tgene | FGR | chr1:27755271 | chr1:27939861 | ENST00000399173 | 10 | 13 | 263_516 | 416.3333333333333 | 530.0 | Domain | Protein kinase | |
| Tgene | FGR | chr1:27755271 | chr1:27939861 | ENST00000399173 | 10 | 13 | 77_138 | 416.3333333333333 | 530.0 | Domain | SH3 | |
| Tgene | FGR | chr1:27755271 | chr1:27939861 | ENST00000374004 | 8 | 11 | 269_277 | 416.3333333333333 | 530.0 | Nucleotide binding | ATP | |
| Tgene | FGR | chr1:27755271 | chr1:27939861 | ENST00000374005 | 10 | 13 | 269_277 | 416.3333333333333 | 530.0 | Nucleotide binding | ATP | |
| Tgene | FGR | chr1:27755271 | chr1:27939861 | ENST00000399173 | 10 | 13 | 269_277 | 416.3333333333333 | 530.0 | Nucleotide binding | ATP |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| WASF2 | |
| FGR |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to WASF2-FGR |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to WASF2-FGR |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies