Home

Download

Statistics

Examples

Help

Contact

	Gene Summary
	Translation studies in PubMed
	Exon Skipping Events
	Expression
	Expression Regulation
	Associated Genes
	Protein 3D Structure
	Protein-Protein Interaction
	Mutations
	Prognostic Analysis
	Gender Association
	Age Association
	Related Drugs
	Related Diseases

Translation Factor: YTHDF1 (NCBI Gene ID:54915)

Gene Summary

Gene Summary

Gene Information	Gene Name: YTHDF1
	Gene ID: 54915
	Gene Symbol	YTHDF1
	Gene ID	54915
	Gene Name	YTH N6-methyladenosine RNA binding protein 1
	Synonyms	C20orf21
	Cytomap	20q13.33
	Type of Gene	protein-coding
	Description	YTH domain-containing family protein 1DACA-1YTH N(6)-methyladenosine RNA binding protein 1YTH domain family 1YTH domain family protein 1YTH domain family, member 1dermatomyositis associated with cancer putative autoantigen 1
	Modification date	20200313
	UniProtAcc	Q9BYJ9

Child GO biological process term(s) under GO:0006412

GO ID	GO term
GO:0017148	Negative regulation of translation
GO:0006417	Regulation of translation
GO:0045727	Positive regulation of translation
GO:0006413	Translational initiation
GO:0006412	Translation

Gene ontology of translaction factor with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Hgene	YTHDF1	GO:0045948	positive regulation of translational initiation	26046440

Inferred gene age of translation factor.

Gene	Inferred gene age group among (0 - 67.6], (67.6 - 355.7], (355.7 - 733], (733 - 1119.25], >1119.25
YTHDF1	(733 - 1119.25]

Top

Translation Studies in PubMed

We searched PubMed using 'YTHDF1[title] AND translation [title] AND human.'

Gene	Title	PMID
YTHDF1	HIF-1α-induced expression of m6A reader YTHDF1 drives hypoxia-induced autophagy and malignancy of hepatocellular carcinoma by promoting ATG2A and ATG14 translation	33619246

Top

Exon Skipping Events

Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure.
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
For more annotations, please visit our ExonSkipDB.

Open reading frame (ORF) analsis of exon skipping events based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.

ENST	Exon skip start (DNA)	Exon Skip end (DNA)	ORF
ENST00000370339	61833638	61835159	In-frame
ENST00000370339	61845215	61845295	Frame-shift

Exon skipping position in the amino acid sequence.

ENST	Exon skip start (DNA)	Exon Skip end (DNA)	Len(transcript seq)	Exon skip start (mRNA)	Exon Skip end (mRNA)	Len(amino acid seq)	Exon skip start (AA)	Exon Skip end (AA)
ENST00000370339	61833638	61835159	3318	475	1995	559	44	551

Potentially (partially) lost protein functional features of UniProt.

UniProtAcc	Exon skip start (AA)	Exon Skip end (AA)	Function feature start (AA)	Function feature end (AA)	Functional feature type	Functional feature desc.
Q9BYJ9	44	551	2	559	Chain	ID=PRO_0000223073;Note=YTH domain-containing family protein 1
Q9BYJ9	44	551	389	523	Domain	Note=YTH;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00225
Q9BYJ9	44	551	395	397	Region	Note=N6-methyladenosine binding;Ontology_term=ECO:0000244,ECO:0000269;evidence=ECO:0000244\|PDB:4RCJ,ECO:0000269\|PubMed:26318451;Dbxref=PMID:26318451
Q9BYJ9	44	551	411	412	Region	Note=N6-methyladenosine binding;Ontology_term=ECO:0000244,ECO:0000269;evidence=ECO:0000244\|PDB:4RCJ,ECO:0000269\|PubMed:26318451;Dbxref=PMID:26318451
Q9BYJ9	44	551	241	331	Compositional bias	Note=Gln/Pro-rich
Q9BYJ9	44	551	401	401	Binding site	Note=N6-methyladenosine;Ontology_term=ECO:0000244,ECO:0000269;evidence=ECO:0000244\|PDB:4RCJ,ECO:0000269\|PubMed:26318451;Dbxref=PMID:26318451
Q9BYJ9	44	551	441	441	Binding site	Note=N6-methyladenosine;Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:Q9Y5A9
Q9BYJ9	44	551	465	465	Binding site	Note=N6-methyladenosine;Ontology_term=ECO:0000244,ECO:0000269;evidence=ECO:0000244\|PDB:4RCJ,ECO:0000269\|PubMed:26318451;Dbxref=PMID:26318451
Q9BYJ9	44	551	470	470	Binding site	Note=N6-methyladenosine;Ontology_term=ECO:0000244,ECO:0000269;evidence=ECO:0000244\|PDB:4RCJ,ECO:0000269\|PubMed:26318451;Dbxref=PMID:26318451
Q9BYJ9	44	551	182	182	Modified residue	Note=Phosphoserine;Ontology_term=ECO:0000244;evidence=ECO:0000244\|PubMed:23186163;Dbxref=PMID:23186163
Q9BYJ9	44	551	1	190	Alternative sequence	ID=VSP_006815;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q9BYJ9	44	551	191	260	Alternative sequence	ID=VSP_006816;Note=In isoform 2. KIGDVSSSAVKTVGSVVSSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGL->MLFLGSLGAWGTTSISTGSIFSLKTLRSQHGGQVGLKVSRPRAPRMGAATPTPRAPWVARWLMGSQAFTATPSAR;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q9BYJ9	44	551	383	559	Alternative sequence	ID=VSP_006817;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q9BYJ9	44	551	397	397	Mutagenesis	Note=Strongly reduced binding to N6-methyladenosine (m6A)-containing RNAs. Y->A;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:26318451;Dbxref=PMID:26318451
Q9BYJ9	44	551	401	401	Mutagenesis	Note=Increased binding to N6-methyladenosine (m6A)-containing RNAs. D->N;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:26318451;Dbxref=PMID:26318451
Q9BYJ9	44	551	411	411	Mutagenesis	Note=Abolished binding to N6-methyladenosine (m6A)-containing RNAs. W->A;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:26318451;Dbxref=PMID:26318451
Q9BYJ9	44	551	465	465	Mutagenesis	Note=Abolished binding to N6-methyladenosine (m6A)-containing RNAs. W->A;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:26318451;Dbxref=PMID:26318451
Q9BYJ9	44	551	470	470	Mutagenesis	Note=Abolished binding to N6-methyladenosine (m6A)-containing RNAs. W->A;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:26318451;Dbxref=PMID:26318451
Q9BYJ9	44	551	506	506	Mutagenesis	Note=Reduced binding to N6-methyladenosine (m6A)-containing RNAs. R->A;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:26318451;Dbxref=PMID:26318451
Q9BYJ9	44	551	123	124	Sequence conflict	Note=FP->AR;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q9BYJ9	44	551	283	284	Sequence conflict	Note=AP->PH;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q9BYJ9	44	551	366	374	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	390	397	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	399	408	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	415	428	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	434	440	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	443	452	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	457	459	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	465	467	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	473	485	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	486	488	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	489	491	Turn	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	495	497	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	502	504	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	513	525	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	532	535	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ
Q9BYJ9	44	551	536	550	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:4RCJ

Top

Expression

Gene expression level across TCGA pancancer

Gene expression level across GTEx pantissue

Expression level of gene isoforms across TCGA pancancer

Expression level of gene isoforms across GTEx pantissue

Cancer(tissue) type-specific expression level of Translation factor using z-score distriution

Differential expression between tumor and matched normal (in the cancer types with more than 10 matched samples)

Cancer type	Translation factor	FC	adj.pval
KIRP	YTHDF1	-1.2717266330147	3.17529775202275e-05
KICH	YTHDF1	-1.28076147925582	8.80360603332519e-05

Top

Expression Regulation

Translation factor expression regulation through miRNA binding

Cancer type

Gene

miRNA

TargetScan binding score (Context++ score percentile)

Coefficient

Pvalue

Translation factor expression regulation through methylation in the promoter of Translation factor

Cancer type	Gene	methyl group b	methyl group a	DEG pval	avg methyl in b	avg methyl in a	avg exp in b	avg exp in a
MESO	YTHDF1	2	1	0.0461270201745817	0.214731960227273	0.180369331395349	0.668719713226264	0.396459723797177

Translation factor expression regulation through methylation in the gene body of Translation factor (positive regulation)

Cancer type

Gene

methyl group b

methyl group a

DEG pval

avg methyl in b

avg methyl in a

avg exp in b

avg exp in a

Translation factor expression regulation through copy number variation of Translation factor

Cancer type	Gene	Coefficient	Pvalue
LGG	YTHDF1	0.183218141	0.011724122

Top

Associated Genes

Strongly correlated genes belong to cellular important gene groups with YTHDF1 (coefficient>0.8, pval<0.05, node color based on FC between tumor and matched normal). Significantly associated important genes in the individual cancer types. * Cell metabolism gene: cell metabolism genes from REACTOME (black edge), IUPHAR: drug target genes from IUPHAR (blue edge), Kinase: human kinase genes (brown edge), CGC: cancer gene census genes (orange edge), TSG: tumor suppresor genes (purple edge), Epifactor: epigenetic factors (light blue edge), TF: transcription factors (green)

Cancer type	Gene group	Translation factor	Correlated gene	Coefficient	Pvalue
COAD	Cell metabolism gene	YTHDF1	MOCS3	0.80089301	8.18E-75
COAD	Cell metabolism gene	YTHDF1	RAE1	0.833159906	4.00E-86
COAD	CGC	YTHDF1	SS18L1	0.817845616	1.78E-80
COAD	Epifactor	YTHDF1	ADNP	0.806179678	1.61E-76
COAD	Epifactor	YTHDF1	SS18L1	0.817845616	1.78E-80
COAD	Epifactor	YTHDF1	TAF4	0.86533452	4.06E-100
COAD	TF	YTHDF1	GMEB2	0.805260314	3.22E-76
COAD	TF	YTHDF1	ADNP	0.806179678	1.61E-76
READ	Cell metabolism gene	YTHDF1	RAE1	0.835636992	1.48E-28
READ	Epifactor	YTHDF1	TAF4	0.876807085	1.57E-34
READ	TF	YTHDF1	GMEB2	0.807079179	2.61E-25
STAD	Epifactor	YTHDF1	TAF4	0.81716281	2.95E-109

Top

Protein structure

Protein 3D structure
Visit iCn3D.

Top

Protein-Protein Interaction

Protein-protein interaction networks
* Overlap between up-regulated DEGs (log2FC<-1 and adj.P<0.05) and STRING PPI network (center: Translation factor, node: DEGs, edges: weighted by -log2(adj.P))

Overlap between down-regulated DEGs (log2FC>1 and adj.P<0.05) and STRING PPI network (center: Translation factor, node: DEGs, edges: weighted by -log2(adj.P))

* Edge colors based on TCGA cancer types.

* Overlap between DEGs (log2FC>1 and adj.P<0.05) and STRING PPI network per cancer (center: Translation factor, node: DEGs, node color: log2FC, edges: weighted by -log2(adj.P))

Cancer type	Translation factor	Interacting protein coding gene	FC	adj.pval
COAD	YTHDF1	ALKBH5	2.13755552147488	0.000465095043182374
KIRC	YTHDF1	RBM15	-1.35007713201106	0.000600141235926365
COAD	YTHDF1	KIAA1429	-3.39420981646075	0.000664144754409791
LUAD	YTHDF1	METTL14	-1.43596594596523	0.00121089428940613
PRAD	YTHDF1	RBM15	-1.09327807917714	0.00277499505363991
HNSC	YTHDF1	ALKBH1	-2.39538842109683	0.00633394569399571
LUAD	YTHDF1	WTAP	-1.78616226090853	0.00791615044666943
LUAD	YTHDF1	RBM15	-1.24579793729144	0.0103856608841715
KIRC	YTHDF1	WTAP	-2.70273660495067	0.0143053039058135
BLCA	YTHDF1	WTAP	-2.90881954846739	0.0159721374511719
STAD	YTHDF1	KIAA1429	-1.61567103280556	0.020511694252491
READ	YTHDF1	ALKBH5	2.44404366714817	0.03125
CHOL	YTHDF1	KIAA1429	-2.83229200442768	0.0390625
CHOL	YTHDF1	METTL3	-3.31943495691848	0.0390625
UCEC	YTHDF1	WTAP	-3.78629147221377	0.046875
THCA	YTHDF1	ALKBH5	-1.26370742071388	1.35265985423686e-05
COAD	YTHDF1	METTL3	-3.54288918740857	2.08616256713867e-06
THCA	YTHDF1	KIAA1429	1.4688007829704	2.5764473552472e-05
THCA	YTHDF1	METTL14	-2.3091931665824	3.03433720687169e-07
BRCA	YTHDF1	FTO	-2.09494010696594	3.14552302519821e-23
LIHC	YTHDF1	METTL3	-1.43381447667708	3.17814170396599e-08
KIRC	YTHDF1	FTO	1.08234124384934	4.81926317698848e-12
PRAD	YTHDF1	METTL3	2.27777667743557	5.10126106041513e-07
HNSC	YTHDF1	RBM15	1.40615182569303	5.61373060463667e-05
THCA	YTHDF1	WTAP	-2.89392443867004	5.83719995580266e-05
KIRC	YTHDF1	ALKBH5	1.22008443269992	8.228320553924e-07

Protein-protein interactors with this translation factor (BIOGRID-3.4.160)

PPI interactors with YTHDF1

G3BP1, POT1, IRAK2, ITSN2, ELAVL1, CUL3, SERPINH1, LRSAM1, SF3B4, NQO1, RPA1, RPA2, RPA3, AGO2, CDKN1A, TP53, NXF1, RNF2, BMI1, CTSG, ANKRD29, SLC25A11, MFGE8, DNASE2B, KCNJ10, PRELP, PSKH2, SAV1, EMID1, LPPR2, ACADSB, ASPSCR1, USP5, B9D2, MKS1, CEP97, CEP128, CEP135, SCLT1, DCTN1, XPO1, RPL10, MCM2, ESR1, FAF1, EGFR, YTHDF3, TUT1, FAM136A, ST8SIA3, CDIPT, ACOX3, SYNCRIP, DNAJC11, FADS3, CCL22, KIAA1683, TMEM184B, MEPCE, ORF10, TNIP2, ESR2, FBL, RC3H2, RBX1, ZC3H7A, RPS6KA2, SNRNP70, LASP1, FAM168A, HSF4, OIP5, AES, ABHD11, MSX2, HEY1, VPS37C, BATF2, MAGED1, PRR32, KRTAP8-1, ZNF34, KRTAP26-1, KRTAP13-1, C6orf15, KRTAP7-1, PLEKHA4, HCVgp1, N, nsp13, nsp16, nsp9, ANKRD17, CELF1, CNOT2, RQCD1, DAZL, DDX3X, EIF4ENIF1, FAM120C, FMR1, FUBP3, FXR1, FXR2, HELZ, IGF2BP2, LSM14A, KIAA0430, MEX3B, PABPC1, PRRC2A, PUM1, RBM47, RBMS1, SMAP2, TDRD3, TNRC6B, UBAP2L, AGO1, AGO3, ALG13, ANKHD1-EIF4EBP3, ATXN2, CNOT1, CNOT10, CNOT3, CPEB4, CSDE1, DDX6, G3BP2, LARP4B, OTUD4, PABPC4, PRRC2B, PRRC2C, PUM2, R3HDM1, RC3H1, SECISBP2, SMG7, TNRC6A, TOP3B, UPF1, USP10, YTHDF2, ZFP36, UNK, CAPRIN1, CEP85, CNOT7, FAM120A, GRSF1, LARP4, LSM12, FAM195A, PRMT1, UBAP2, ZC3HAV1, IGF2BP1, FAM195B, PATL1, CNOT11, DZIP3, PAN2, KIF14, MKI67, RBM39, AKAP1, HSD3B7, RPS20, SERBP1, FZR1, C1orf35, RPL19, AKR7L, SLC25A3, PRKY, ABT1, RPS16, RPS3, PTH2R, SLC25A12, PIP, RPL3, RPL26L1, IGHD, FUT7, HSPA12B, TECR, OR10H1, ZNF76, COQ3, SBK1, BLK, ZKSCAN8, HSPA1A, TNFSF14, COQ4, MLC1, KCTD12, ZNF653, PURG, H2AFB2, RPS2, CMAS, SOHLH1, LHFPL4, METTL21B, NPAS1, CLEC11A, RPL31, MICU2, LIN28A, PSG11, RPSAP58, RPS19, C12orf57, ZMAT5, QRSL1, PRKCSH, DNAJC8, RPSA, FAM96A, RPS4Y1, TOLLIP, RPS10, SAR1B, NPRL2, HIST1H1E, UBXN6, MGARP, CEP19, RBFOX2, BICD2, QKI, PPIL3, TMED9, SNRPA, DMRTB1, CPSF7, CTTN, MOV10, RBMS3, XRN2, ERI3, SF1, SARNP, RBM22, DYNC1I1, RBPMS, FHIT, CLK2, DHX30, Nudt21, Dynlt1b, Rbm14, Dynlrb1, Ube2i, Eif4a1, Rbm38, Fez2, Ywhaz, Bbs5, Mapre2, Gtf2f1, Rps15, Pef1, Nsa2, Acta1, Npm3, Fbl, Grb2, Gnb2l1, CTSL, FURIN, IFITM1, IFITM3, CLEC4D, ACE2, CLEC4E, E, M, nsp1, nsp11, nsp12, nsp15, nsp3, nsp4, nsp5, nsp8, ORF6, S, CPEB1, GCM1, GLI3, ISX, KLF16,

Top

Mutations

Clinically associated variants from ClinVar.

Gene	Chr	Position	RefSeq	VarSeq	RefSeeq	VarType	Pathogenic	Disease	VarInfo
YTHDF1	chr20	61833801	G	A	single_nucleotide_variant	Benign	not_provided	SO:0001819\|synonymous_variant	SO:0001819\|synonymous_variant
YTHDF1	chr20	61833834	A	G	single_nucleotide_variant	Benign	not_provided	SO:0001819\|synonymous_variant	SO:0001819\|synonymous_variant
YTHDF1	chr20	61833873	C	T	single_nucleotide_variant	Benign	not_provided	SO:0001819\|synonymous_variant	SO:0001819\|synonymous_variant
YTHDF1	chr20	61834169	G	A	single_nucleotide_variant	Benign	not_provided	SO:0001583\|missense_variant	SO:0001583\|missense_variant
YTHDF1	chr20	61834536	G	A	single_nucleotide_variant	Benign	not_provided	SO:0001819\|synonymous_variant	SO:0001819\|synonymous_variant
YTHDF1	chr20	61834707	G	A	single_nucleotide_variant	Benign	not_provided	SO:0001819\|synonymous_variant	SO:0001819\|synonymous_variant
YTHDF1	chr20	61834857	G	A	single_nucleotide_variant	Benign	not_provided	SO:0001819\|synonymous_variant	SO:0001819\|synonymous_variant

nsSNVs with sample frequency (size of circle) from TCGA 33 cancers.

SNVs and Indels

Gene	Cancer type	Chromosome	Start	End	RefSeeq	MutSeq	Mutation type	AAchange	# samples
YTHDF1	PRAD	chr20	61834477	61834477	C	T	Missense_Mutation	p.G272D	4
YTHDF1	ACC	chr20	61834292	61834292	T	C	Missense_Mutation	p.R334G	4
YTHDF1	BRCA	chr20	61835143	61835143	G	C	Nonsense_Mutation	p.S50*	4
YTHDF1	KIRP	chr20	61833792	61833792	T	C	Silent	p.K500K	3
YTHDF1	SKCM	chr20	61834443	61834443	G	A	Silent	p.A283A	3
YTHDF1	SKCM	chr20	61834932	61834932	G	A	Silent	p.F120F	3
YTHDF1	BRCA	chr20	61834555	61834555	G	T	Missense_Mutation	p.P246H	3
YTHDF1	ESCA	chr20	61834342	61834342	T	A	Missense_Mutation	p.Y317F	3
YTHDF1	BRCA	chr20	61833786	61833786	G	A	Silent	p.V502	3
YTHDF1	BRCA	chr20	61834026	61834026	G	A	Silent	p.D422	3
YTHDF1	UCEC	chr20	61834124	61834124	G	A	Missense_Mutation	p.R390C	3
YTHDF1	PAAD	chr20	61834989	61834989	G	A	Silent	p.H101H	3
YTHDF1	SKCM	chr20	61835093	61835093	G	A	Missense_Mutation	p.P67S	3
YTHDF1	BRCA	chr20	61835025	61835025	G	A	Silent	p.Y89	3
YTHDF1	UCEC	chr20	61834673	61834673	C	T	Missense_Mutation	p.V207I	3
YTHDF1	UCEC	chr20	61833787	61833787	A	G	Missense_Mutation	p.V502A	3
YTHDF1	UCS	chr20	61835075	61835075	C	-	Frame_Shift_Del	p.A73fs	3
YTHDF1	PAAD	chr20	61834082	61834082	G	A	Missense_Mutation	p.R404C	3
YTHDF1	SKCM	chr20	61834702	61834702	G	A	Missense_Mutation	p.S197F	2
YTHDF1	UCEC	chr20	61834119	61834119	C	T	Silent	p.V391	2
YTHDF1	STAD	chr20	61833667	61833667	C	T	Missense_Mutation	p.R542H	2
YTHDF1	BLCA	chr20	61835099	61835099	C	T	Missense_Mutation	p.G65R	2
YTHDF1	LIHC	chr20	61833852	61833852	A	-	Frame_Shift_Del	p.F480fs	2
YTHDF1	STAD	chr20	61833843	61833843	A	G	Silent	p.D483D	2
YTHDF1	UCEC	chr20	61834757	61834757	C	T	Missense_Mutation	p.G179R	2
YTHDF1	LGG	chr20	61833842	61833842	C	T	Missense_Mutation	p.V484I	2
YTHDF1	STAD	chr20	61845261	61845261	A	C	Silent	p.V29V	2
YTHDF1	SKCM	chr20	61834758	61834758	G	A	Silent	p.P178P	2
YTHDF1	UCEC	chr20	61834908	61834908	C	T	Missense_Mutation	p.R27H	2
YTHDF1	LUAD	chr20	61834123	61834123	C	G	Missense_Mutation	p.R390P	2
YTHDF1	PAAD	chr20	61834989	61834989	G	A	Silent		2
YTHDF1	HNSC	chr20	61834905	61834905	G	C	Missense_Mutation	p.F129L	2
YTHDF1	SKCM	chr20	61834435	61834435	G	A	Missense_Mutation	p.P286L	2
YTHDF1	STAD	chr20	61834233	61834233	G	A	Silent	p.N353N	2
YTHDF1	SKCM	chr20	61834759	61834759	G	A	Missense_Mutation	p.P178L	2
YTHDF1	UCEC	chr20	61834980	61834980	A	C	Missense_Mutation	p.F3C	2
YTHDF1	LGG	chr20	61833842	61833842	C	T	Missense_Mutation		2
YTHDF1	PAAD	chr20	61834082	61834082	G	A	Missense_Mutation		2
YTHDF1	SKCM	chr20	61834966	61834966	C	T	Missense_Mutation	p.G109E	2
YTHDF1	BRCA	chr20	61834989	61834989	G	A	Silent	p.H101	2
YTHDF1	SKCM	chr20	61833649	61833649	A	G	Missense_Mutation	p.V548A	2
YTHDF1	UCEC	chr20	61835024	61835024	C	T	Missense_Mutation	p.G90R	2
YTHDF1	STAD	chr20	61828078	61828078	C	G	Missense_Mutation		2
YTHDF1	HNSC	chr20	61833966	61833966	C	A	Silent	p.G442G	2
YTHDF1	SKCM	chr20	61834637	61834637	T	A	Missense_Mutation	p.N219Y	2
YTHDF1	STAD	chr20	61834535	61834535	C	T	Missense_Mutation	p.G253R	2
YTHDF1	SKCM	chr20	61834424	61834424	G	A	Missense_Mutation	p.P290S	2
YTHDF1	UCEC	chr20	61833775	61833775	C	T	Missense_Mutation	p.R506Q	2
YTHDF1	UCEC	chr20	61845257	61845257	C	A	Missense_Mutation	p.D31Y	2
YTHDF1	ESCA	chr20	61834342	61834342	T	A	Missense_Mutation		2
YTHDF1	LUAD	chr20	61834033	61834033	C	A	Missense_Mutation	p.R420L	2
YTHDF1	STAD	chr20	61833992	61833992	C	T	Missense_Mutation	p.V434I	2
YTHDF1	SKCM	chr20	61835086	61835086	G	A	Missense_Mutation	p.S69F	2
YTHDF1	SKCM	chr20	61833777	61833777	G	A	Silent	p.S505S	2
YTHDF1	UCEC	chr20	61846934	61846934	T	G	Missense_Mutation	p.N16T	2
YTHDF1	LUAD	chr20	61833654	61833654	C	A	Missense_Mutation	p.E546D	2
YTHDF1	STAD	chr20	61828078	61828078	C	G	Missense_Mutation	p.Q554H	2
YTHDF1	SKCM	chr20	61834905	61834905	G	A	Silent	p.F129F	2
YTHDF1	SKCM	chr20	61834136	61834136	G	A	Silent	p.L386L	2
YTHDF1	SKCM	chr20	61835041	61835041	G	A	Missense_Mutation	p.P84L	2
YTHDF1	HNSC	chr20	61846954	61846954	C	G	Splice_Site		2
YTHDF1	KIRC	chr20	61833738	61833738	T	-	Frame_Shift_Del	p.Q518fs	2
YTHDF1	SKCM	chr20	61833879	61833879	C	T	Silent	p.K471K	2
YTHDF1	LIHC	chr20	61835084	61835084	G	-	Frame_Shift_Del	p.L70fs	2
YTHDF1	SKCM	chr20	61835092	61835092	G	A	Missense_Mutation	p.P67L	2
YTHDF1	UCEC	chr20	61833723	61833723	G	T	Silent	p.I523	2
YTHDF1	STAD	chr20	61835025	61835025	G	A	Silent	p.Y89Y	2
YTHDF1	STAD	chr20	61834049	61834049	C	A	Nonsense_Mutation	p.E415*	1
YTHDF1	BLCA	chr20	61833723	61833723	G	C	Missense_Mutation	p.I523M	1
YTHDF1	COAD	chr20	61834284	61834284	C	T	Silent	p.A336A	1
YTHDF1	LIHC	chr20	61834194	61834194	G	-	Frame_Shift_Del	p.P366fs	1
YTHDF1	SKCM	chr20	61845283	61845283	G	A	Missense_Mutation	p.S22L	1
YTHDF1	HNSC	chr20	61828074	61828074	G	C	Missense_Mutation		1
YTHDF1	OV	chr20	61304644	61304644	G	A	Missense_Mutation		1
YTHDF1	STAD	chr20	61833652	61833652	T	A	Missense_Mutation	p.E547V	1
YTHDF1	KIRP	chr20	61833792	61833792	T	C	Silent		1
YTHDF1	COAD	chr20	61834287	61834287	G	A	Silent	p.N335N	1
YTHDF1	SKCM	chr20	61835042	61835042	G	A	Missense_Mutation	p.P84S	1
YTHDF1	HNSC	chr20	61834856	61834856	C	G	Missense_Mutation		1
YTHDF1	OV	chr20	61834694	61834694	C	T	Missense_Mutation	p.V200I	1
YTHDF1	READ	chr20	61834908	61834908	C	T	Silent	p.A128A	1
YTHDF1	STAD	chr20	61833646	61833646	A	G	Missense_Mutation	p.V549A	1
YTHDF1	BLCA	chr20	61833650	61833652	CCT	-	In_Frame_Del	p.E547del	1
YTHDF1	COAD	chr20	61834725	61834725	G	A	Silent	p.G189G	1
YTHDF1	LIHC	chr20	61835054	61835054	C	-	Frame_Shift_Del	p.D80fs	1
YTHDF1	SKCM	chr20	61834922	61834922	G	A	Missense_Mutation	p.P124S	1
YTHDF1	HNSC	chr20	61834856	61834856	C	G	Missense_Mutation	p.A146P	1
YTHDF1	SARC	chr20	61834014	61834014	G	T	Silent		1
YTHDF1	TGCT	chr20	61833918	61833918	G	A	Silent	p.Y458Y	1
YTHDF1	BLCA	chr20	61834432	61834433	-	G	Frame_Shift_Ins	p.Q287fs	1
YTHDF1	LGG	chr20	61828083	61828083	G	A	Missense_Mutation	p.R553W	1
YTHDF1	COAD	chr20	61845263	61845263	C	A	Missense_Mutation	p.V29F	1
YTHDF1	SKCM	chr20	61833700	61833700	G	A	Missense_Mutation	p.S531F	1
YTHDF1	THCA	chr20	61834092	61834092	G	A	Silent		1
YTHDF1	DLBC	chr20	61834169	61834169	G	A	Missense_Mutation	p.H375Y	1
YTHDF1	LUAD	chr20	61834126	61834126	C	A	Missense_Mutation	p.G389V	1
YTHDF1	STAD	chr20	61833992	61833992	C	T	Missense_Mutation		1
YTHDF1	HNSC	chr20	61828074	61828074	G	C	Missense_Mutation	p.R556G	1
YTHDF1	STAD	chr20	61834828	61834828	G	-	Frame_Shift_Del	p.P155fs	1
YTHDF1	LGG	chr20	61828083	61828083	G	A	Missense_Mutation		1
YTHDF1	THYM	chr20	61834068	61834068	G	T	Nonsense_Mutation	p.Y408X	1
YTHDF1	LUAD	chr20	61834373	61834373	C	A	Missense_Mutation	p.A307S	1
YTHDF1	PAAD	chr20	61833800	61833800	C	A	Missense_Mutation		1
YTHDF1	BLCA	chr20	61834958	61834958	C	T	Missense_Mutation		1
YTHDF1	LIHC	chr20	61845268	61845268	T	C	Missense_Mutation		1
YTHDF1	PAAD	chr20	61833689	61833689	C	A	Missense_Mutation		1
YTHDF1	BLCA	chr20	61834432	61834433	-	-	Frame_Shift_Ins		1
YTHDF1	HNSC	chr20	61846954	61846954	C	G	Splice_Site	p.R10_splice	1
YTHDF1	STAD	chr20	61835152	61835152	C	T	Missense_Mutation	p.S47N	1
YTHDF1	LIHC	chr20	61834090	61834090	T	C	Missense_Mutation	p.D401G	1
YTHDF1	GBM	chr20	61835019	61835019	C	A	Missense_Mutation		1
YTHDF1	BLCA	chr20	61834620	61834620	C	A	Silent		1
YTHDF1	KIRC	chr20	61834018	61834018	A	G	Missense_Mutation	p.F425S	1
YTHDF1	STAD	chr20	61834910	61834910	C	T	Missense_Mutation	p.A128T	1
YTHDF1	LIHC	chr20	61835049	61835049	A	G	Silent	p.P81P	1
YTHDF1	UCS	chr20	61835075	61835075	C	-	Frame_Shift_Del		1
YTHDF1	HNSC	chr20	61833966	61833966	C	A	Silent		1
YTHDF1	LUAD	chr20	61834884	61834884	C	-	Frame_Shift_Del	p.G136fs	1
YTHDF1	PAAD	chr20	61833689	61833689	C	A	Missense_Mutation	p.D535Y	1
YTHDF1	STAD	chr20	61834049	61834049	C	A	Nonsense_Mutation	p.E415X	1
YTHDF1	BLCA	chr20	61835099	61835099	C	T	Missense_Mutation		1
YTHDF1	KIRC	chr20	61845285	61845285	A	G	Silent	p.G21G	1
YTHDF1	STAD	chr20	61835087	61835087	A	G	Missense_Mutation	p.S69P	1
YTHDF1	LIHC	chr20	61835053	61835053	T	C	Missense_Mutation	p.D80G	1
YTHDF1	LUSC	chr20	61833927	61833927	G	A	Silent	p.P455P	1
YTHDF1	STAD	chr20	61834930	61834930	T	A	Missense_Mutation	p.N121I	1
YTHDF1	BLCA	chr20	61834958	61834958	C	T	Missense_Mutation	p.G112R	1
YTHDF1	STAD	chr20	61834968	61834968	A	G	Silent	p.P108P	1
YTHDF1	CHOL	chr20	61834909	61834909	G	A	Missense_Mutation	p.A128V	1
YTHDF1	HNSC	chr20	61834905	61834905	G	C	Missense_Mutation		1
YTHDF1	LUSC	chr20	61834312	61834312	C	A	Missense_Mutation	p.R327L	1
YTHDF1	PRAD	chr20	61834854	61834854	C	T	Silent	p.A146A	1

Copy number variation (CNV) of YTHDF1
* Click on the image to open the original image in a new window.

Fusion gene breakpoints (product of the structural variants (SVs)) across YTHDF1
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Fusion genes with this translation factor from FusionGDB2.0.

FusionGDB2 ID	Disease	Sample	Hgene	Hchr	Hbp	Hstrand	Tgene	Tchr	Tbp	Tstrand
100101	OV	TCGA-24-1556	KIAA1598	chr10	118764532	-	YTHDF1	chr20	61828086	-
100101	OV	TCGA-24-1556-01A	KIAA1598	chr10	118764533	-	YTHDF1	chr20	61828086	-
100101	STAD	TCGA-HU-A4GN-01A	SLCO4A1	chr20	61273905	+	YTHDF1	chr20	61828086	-
100101	HNSC	TCGA-CN-5360	YTHDF1	chr20	61845215	-	C11orf24	chr11	68035719	-
100101	STAD	TCGA-CD-8530-01A	YTHDF1	chr20	61845216	-	FAM173B	chr5	10227759	-
100101	SKCM	TCGA-EE-A2MH-06A	YTHDF1	chr20	61833639	-	RP11-1102P16.1	chr8	72448083	-
100101	STAD	TCGA-D7-A4YU	YTHDF1	chr20	61845215	-	STAG2	chrX	123156380	+
100101	N/A	AA405604	YTHDF1	chr20	61834469	-	YTHDF1	chr20	61834962	-

Top

Prognostic Analysis

Kaplan-Meier plots with logrank tests of overall survival (OS)

Cancer type

Translation factor

Coefficent

Hazard ratio

Wald test pval

Likelihool ratio pval

Logrank test pval

# samples

Top

Translation factor and Gender

Differential gene expression between female and male. (Wilcoxon test, pval<0.05)

Cancer type	Translation factor	pval	adj.p
THCA	YTHDF1	0.000154113282685855	0.0043
ACC	YTHDF1	0.000204613523719377	0.0055
BRCA	YTHDF1	0.00503684475672542	0.13
STAD	YTHDF1	0.0376561275826296	0.94
LIHC	YTHDF1	0.0473337188090333	1
BLCA	YTHDF1	0.0474215658242804	1

Top

Translation factor and Age

Differential gene expression between young and old age groups (Wilcoxon test, pval<0.05)

Cancer type	Translation factor	pval	adj.p
THCA	YTHDF1	0.00152908159607024	0.049
LGG	YTHDF1	1.26555429530783e-05	0.00042
OV	YTHDF1	0.00753762196305926	0.22
UCEC	YTHDF1	0.00586021329674886	0.18
UCS	YTHDF1	0.00648341837667949	0.19

Top

Related Drugs

Drugs targeting genes involved in this translation factor.
(DrugBank Version 5.1.8 2021-05-08)

UniProtAcc

DrugBank ID

Drug name

Drug activity

Drug type

Drug status

Top

Related Diseases

Diseases associated with this translation factor.
(DisGeNet 4.0)

Disease ID

Disease Name

# PubMeds

Disease source