|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:RANBP2-YWHAE (FusionGDB2 ID:HG5903TG7531) |
Fusion Gene Summary for RANBP2-YWHAE |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: RANBP2-YWHAE | Fusion gene ID: hg5903tg7531 | Hgene | Tgene | Gene symbol | RANBP2 | YWHAE | Gene ID | 5903 | 7531 |
| Gene name | RAN binding protein 2 | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon | |
| Synonyms | ADANE|ANE1|IIAE3|NUP358|TRP1|TRP2 | 14-3-3E|HEL2|KCIP-1|MDCR|MDS | |
| Cytomap | ('RANBP2')('YWHAE') 2q13 | 17p13.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | E3 SUMO-protein ligase RanBP2358 kDa nucleoporinE3 SUMO-protein transferase RanBP2P270acute necrotizing encephalopathy 1 (autosomal dominant)nuclear pore complex protein Nup358nucleoporin 358nucleoporin Nup358ran-binding protein 2transformation-r | 14-3-3 protein epsilon14-3-3 epsilonepididymis luminal protein 2mitochondrial import stimulation factor L subunitprotein kinase C inhibitor protein-1tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptidetyrosine | |
| Modification date | 20200313 | 20200327 | |
| UniProtAcc | P49792 | P62258 | |
| Ensembl transtripts involved in fusion gene | ENST00000283195, | ||
| Fusion gene scores | * DoF score | 20 X 18 X 8=2880 | 25 X 13 X 12=3900 |
| # samples | 21 | 32 | |
| ** MAII score | log2(21/2880*10)=-3.77760757866355 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(32/3900*10)=-3.60733031374961 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: RANBP2 [Title/Abstract] AND YWHAE [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | RANBP2(109336134)-YWHAE(1248793), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | RANBP2-YWHAE seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. RANBP2-YWHAE seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. RANBP2-YWHAE seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. RANBP2-YWHAE seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. RANBP2-YWHAE seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. RANBP2-YWHAE seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. RANBP2-YWHAE seems lost the major protein functional domain in Tgene partner, which is a epigenetic factor due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | RANBP2 | GO:0016925 | protein sumoylation | 17264123|22155184 |
| Tgene | YWHAE | GO:0000165 | MAPK cascade | 12917326 |
| Tgene | YWHAE | GO:0034605 | cellular response to heat | 12917326 |
| Tgene | YWHAE | GO:0046827 | positive regulation of protein export from nucleus | 12917326 |
| Tgene | YWHAE | GO:0051480 | regulation of cytosolic calcium ion concentration | 18029012 |
| Tgene | YWHAE | GO:0060306 | regulation of membrane repolarization | 11953308 |
| Tgene | YWHAE | GO:1901016 | regulation of potassium ion transmembrane transporter activity | 11953308 |
| Tgene | YWHAE | GO:1901020 | negative regulation of calcium ion transmembrane transporter activity | 18029012 |
| Tgene | YWHAE | GO:1902309 | negative regulation of peptidyl-serine dephosphorylation | 11953308 |
| Tgene | YWHAE | GO:1905913 | negative regulation of calcium ion export across plasma membrane | 18029012 |
| Fusion gene breakpoints across RANBP2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across YWHAE (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | STAD | TCGA-CD-A48C-01A | RANBP2 | chr2 | 109336134 | + | YWHAE | chr17 | 1248793 | - |
Top |
Fusion Gene ORF analysis for RANBP2-YWHAE |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| 5CDS-intron | ENST00000283195 | ENST00000498643 | RANBP2 | chr2 | 109336134 | + | YWHAE | chr17 | 1248793 | - |
| Frame-shift | ENST00000283195 | ENST00000264335 | RANBP2 | chr2 | 109336134 | + | YWHAE | chr17 | 1248793 | - |
| Frame-shift | ENST00000283195 | ENST00000575977 | RANBP2 | chr2 | 109336134 | + | YWHAE | chr17 | 1248793 | - |
| In-frame | ENST00000283195 | ENST00000571732 | RANBP2 | chr2 | 109336134 | + | YWHAE | chr17 | 1248793 | - |
| In-frame | ENST00000283195 | ENST00000573026 | RANBP2 | chr2 | 109336134 | + | YWHAE | chr17 | 1248793 | - |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000283195 | RANBP2 | chr2 | 109336134 | + | ENST00000571732 | YWHAE | chr17 | 1248793 | - | 1158 | 198 | 520 | 32 | 162 |
| ENST00000283195 | RANBP2 | chr2 | 109336134 | + | ENST00000573026 | YWHAE | chr17 | 1248793 | - | 843 | 198 | 520 | 32 | 162 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000283195 | ENST00000571732 | RANBP2 | chr2 | 109336134 | + | YWHAE | chr17 | 1248793 | - | 0.8812896 | 0.118710354 |
| ENST00000283195 | ENST00000573026 | RANBP2 | chr2 | 109336134 | + | YWHAE | chr17 | 1248793 | - | 0.9398217 | 0.060178276 |
Top |
Fusion Genomic Features for RANBP2-YWHAE |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
 |
Top |
Fusion Protein Features for RANBP2-YWHAE |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:109336134/chr17:1248793) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| RANBP2 | YWHAE |
| FUNCTION: E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I (PubMed:11792325, PubMed:12032081, PubMed:15378033, PubMed:22194619, PubMed:15931224). Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates (PubMed:7775481). Binds single-stranded RNA (in vitro) (PubMed:7775481). May bind DNA (PubMed:7775481). Component of the nuclear export pathway (PubMed:10078529). Specific docking site for the nuclear export factor exportin-1 (PubMed:10078529). Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB (PubMed:22155184). Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle (PubMed:20386726). Probable inactive PPIase with no peptidyl-prolyl cis-trans isomerase activity (PubMed:20676357, PubMed:23353830). {ECO:0000269|PubMed:11792325, ECO:0000269|PubMed:12032081, ECO:0000269|PubMed:15378033, ECO:0000269|PubMed:15931224, ECO:0000269|PubMed:20386726, ECO:0000269|PubMed:20676357, ECO:0000269|PubMed:22155184, ECO:0000269|PubMed:22194619, ECO:0000269|PubMed:23353830, ECO:0000269|PubMed:7775481, ECO:0000303|PubMed:10078529}. | FUNCTION: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner (By similarity). Positively regulates phosphorylated protein HSF1 nuclear export to the cytoplasm (PubMed:12917326). {ECO:0000250|UniProtKB:P62261, ECO:0000269|PubMed:12917326}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1171_1307 | 24 | 3225.0 | Domain | RanBD1 1 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2012_2148 | 24 | 3225.0 | Domain | RanBD1 2 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2309_2445 | 24 | 3225.0 | Domain | RanBD1 3 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2911_3046 | 24 | 3225.0 | Domain | RanBD1 4 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 3067_3223 | 24 | 3225.0 | Domain | PPIase cyclophilin-type |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1001_3206 | 24 | 3225.0 | Region | 22 X 2 AA repeats of F-G |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2633_2710 | 24 | 3225.0 | Region | Note=Required for E3 SUMO-ligase activity |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2633_2761 | 24 | 3225.0 | Region | Note=2 X 50 AA approximate repeats |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1001_1002 | 24 | 3225.0 | Repeat | 1 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1101_1102 | 24 | 3225.0 | Repeat | 2 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1142_1143 | 24 | 3225.0 | Repeat | 3 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1459_1460 | 24 | 3225.0 | Repeat | 4 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1523_1524 | 24 | 3225.0 | Repeat | 5 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1586_1587 | 24 | 3225.0 | Repeat | 6 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 165_201 | 24 | 3225.0 | Repeat | TPR 4 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1852_1853 | 24 | 3225.0 | Repeat | 7 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1861_1862 | 24 | 3225.0 | Repeat | 8 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1900_1901 | 24 | 3225.0 | Repeat | 9 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1938_1939 | 24 | 3225.0 | Repeat | 10 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1961_1962 | 24 | 3225.0 | Repeat | 11 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2260_2261 | 24 | 3225.0 | Repeat | 12 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2516_2517 | 24 | 3225.0 | Repeat | 13 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2535_2536 | 24 | 3225.0 | Repeat | 14 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2545_2546 | 24 | 3225.0 | Repeat | 15 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 26_59 | 24 | 3225.0 | Repeat | TPR 1 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2711_2761 | 24 | 3225.0 | Repeat | 2 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2840_2841 | 24 | 3225.0 | Repeat | 16 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2842_2843 | 24 | 3225.0 | Repeat | 17 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2863_2864 | 24 | 3225.0 | Repeat | 18 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 287_319 | 24 | 3225.0 | Repeat | TPR 5 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2880_2881 | 24 | 3225.0 | Repeat | 19 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 3106_3107 | 24 | 3225.0 | Repeat | 20 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 3189_3190 | 24 | 3225.0 | Repeat | 21 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 3205_3206 | 24 | 3225.0 | Repeat | 22 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 583_616 | 24 | 3225.0 | Repeat | TPR 6 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 60_93 | 24 | 3225.0 | Repeat | TPR 2 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 648_681 | 24 | 3225.0 | Repeat | TPR 7 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 94_128 | 24 | 3225.0 | Repeat | TPR 3 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1351_1381 | 24 | 3225.0 | Zinc finger | RanBP2-type 1 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1415_1444 | 24 | 3225.0 | Zinc finger | RanBP2-type 2 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1479_1508 | 24 | 3225.0 | Zinc finger | RanBP2-type 3 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1543_1572 | 24 | 3225.0 | Zinc finger | RanBP2-type 4 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1606_1635 | 24 | 3225.0 | Zinc finger | RanBP2-type 5 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1665_1694 | 24 | 3225.0 | Zinc finger | RanBP2-type 6 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1724_1753 | 24 | 3225.0 | Zinc finger | RanBP2-type 7 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 1781_1810 | 24 | 3225.0 | Zinc finger | RanBP2-type 8 |
Top |
Fusion Gene Sequence for RANBP2-YWHAE |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >72072_72072_1_RANBP2-YWHAE_RANBP2_chr2_109336134_ENST00000283195_YWHAE_chr17_1248793_ENST00000571732_length(transcript)=1158nt_BP=198nt CACAGTGGTCCTCCGCCGGCTACGGCGCTGCGTCACTGGTTTGCAGGCGCTTTCCTCTTGGAAGTGGCGACTGCTGCGGGCCTGAGCGCT GGTCTCACGCGCCTCGGGAGCCAGGTTGGCGGCGCGATGAGGCGCAGCAAGGCTGACGTGGAGCGGTACATCGCCTCGGTGCAGGGCTCC ACCCCGTCGCCTCGACAGGTGAAGAGCAGAATAAAGAAGCGCTGCAGGACGTGGAAGACGAAAATCAGTGAGACATAAGCCAACAAGAGA AACCATCTCTGACCACCCCCTCCTCCCCATCCCACCCTTTGGAAACTCCCCATTGTCACTGAGAACCACCAAATCTGACTTTTACATTTG GTCTCAGAATTTAGGTTCCTGCCCTGTTGGTTTTTTTTTTTTTTTTTTAAACAGTTTTCAAAAGTTCTTAAAGGCAAGAGTGAATTTCTG TGGATTTTACTGGTCCCAGCTTTTAGGTTCTTTAAGACACTAACAGGACTACATAGAGGCTTTTTCAGCATTACTGTGTCGTCTCCGTGC CAGATGTGGCAAGATCACCATTAGCAAATGGAAATTACATTTGAAAGCCATTAGACTTATAGGTGATGCAAGCATCTAAGAGAGAGGTTA ATCACACTATAGAGGCATAAGTGGTATCAGTTTTCATTTTTCTAATTGTTTAAACTGTGTTTTATACCAGTGTTTGCAAGTAATTGGGTG TTAGCTTGAGATGGTTAAAGGTGGTTTGGGGAGGGACTTCGTTGTAATGGTTTTGCTGTAAAAAATGTTTCCAACTCCGCTGAAATGTTG CTGAAAAGCATGGTGCTGGTAACAGTTCAACAATCCGTGGCTGCTCATTCTTGCCTACTTTACTCTCCCACTGAAGCAGGTTAGCGTTGA AGGTGGTATGGAAAAGCCTGCATGCCTGTTCAATTCTTTTGTTTCTTCTCCTTCCCCCTCCCCCTACCTCCTTCCCCTCACTCCTCCCCT CCTTCGCTCGCTCAACCTCTTTTGTTCAGTATGTGTAACTTGAAGCTAATTTGTACTACTGGATATCTGACTGGAGCCACAGATACAGAA >72072_72072_1_RANBP2-YWHAE_RANBP2_chr2_109336134_ENST00000283195_YWHAE_chr17_1248793_ENST00000571732_length(amino acids)=162AA_BP=0 MLKKPLCSPVSVLKNLKAGTSKIHRNSLLPLRTFENCLKKKKKNQQGRNLNSETKCKSQIWWFSVTMGSFQRVGWGGGGGQRWFLLLAYV -------------------------------------------------------------- >72072_72072_2_RANBP2-YWHAE_RANBP2_chr2_109336134_ENST00000283195_YWHAE_chr17_1248793_ENST00000573026_length(transcript)=843nt_BP=198nt CACAGTGGTCCTCCGCCGGCTACGGCGCTGCGTCACTGGTTTGCAGGCGCTTTCCTCTTGGAAGTGGCGACTGCTGCGGGCCTGAGCGCT GGTCTCACGCGCCTCGGGAGCCAGGTTGGCGGCGCGATGAGGCGCAGCAAGGCTGACGTGGAGCGGTACATCGCCTCGGTGCAGGGCTCC ACCCCGTCGCCTCGACAGGTGAAGAGCAGAATAAAGAAGCGCTGCAGGACGTGGAAGACGAAAATCAGTGAGACATAAGCCAACAAGAGA AACCATCTCTGACCACCCCCTCCTCCCCATCCCACCCTTTGGAAACTCCCCATTGTCACTGAGAACCACCAAATCTGACTTTTACATTTG GTCTCAGAATTTAGGTTCCTGCCCTGTTGGTTTTTTTTTTTTTTTTTTAAACAGTTTTCAAAAGTTCTTAAAGGCAAGAGTGAATTTCTG TGGATTTTACTGGTCCCAGCTTTTAGGTTCTTTAAGACACTAACAGGACTACATAGAGGCTTTTTCAGCATTACTGTGTCGTCTCCGTGC CAGATGTGGCAAGATCACCATTAGCAAATGGAAATTACATTTGAAAGCCATTAGACTTATAGGTGATGCAAGCATCTAAGAGAGAGGTTA ATCACACTATAGAGGCATAAGTGGTATCAGTTTTCATTTTTCTAATTGTTTAAACTGTGTTTTATACCAGTGTTTGCAAGTAATTGGGTG TTAGCTTGAGATGGTTAAAGGTGGTTTGGGGAGGGACTTCGTTGTAATGGTTTTGCTGTAAAAAATGTTTCCAACTCCGCTGAAATGTTG >72072_72072_2_RANBP2-YWHAE_RANBP2_chr2_109336134_ENST00000283195_YWHAE_chr17_1248793_ENST00000573026_length(amino acids)=162AA_BP=0 MLKKPLCSPVSVLKNLKAGTSKIHRNSLLPLRTFENCLKKKKKNQQGRNLNSETKCKSQIWWFSVTMGSFQRVGWGGGGGQRWFLLLAYV -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for RANBP2-YWHAE |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2147_2287 | 24.0 | 3225.0 | BICD2 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2686_2761 | 24.0 | 3225.0 | SUMO1 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2631_2635 | 24.0 | 3225.0 | sumoylated RANGAP1 |
| Hgene | RANBP2 | chr2:109336134 | chr17:1248793 | ENST00000283195 | + | 1 | 29 | 2633_2685 | 24.0 | 3225.0 | UBE2I |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for RANBP2-YWHAE |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for RANBP2-YWHAE |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | RANBP2 | C2675556 | ENCEPHALOPATHY, ACUTE, INFECTION-INDUCED, SUSCEPTIBILITY TO, 3 | 3 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
| Hgene | RANBP2 | C0334121 | Inflammatory Myofibroblastic Tumor | 2 | CTD_human;ORPHANET |
| Hgene | RANBP2 | C0018199 | Granuloma, Plasma Cell | 1 | CTD_human |
| Hgene | RANBP2 | C4706387 | Acute necrotizing encephalopathy of childhood | 1 | ORPHANET |
| Tgene | C0036341 | Schizophrenia | 4 | PSYGENET | |
| Tgene | C0005586 | Bipolar Disorder | 2 | PSYGENET | |
| Tgene | C0206630 | Endometrial Stromal Sarcoma | 2 | ORPHANET | |
| Tgene | C0027627 | Neoplasm Metastasis | 1 | CTD_human | |
| Tgene | C0265219 | Miller Dieker syndrome | 1 | ORPHANET | |
| Tgene | C0334488 | Clear cell sarcoma of kidney | 1 | ORPHANET | |
| Tgene | C2750748 | Chromosome 17p13.3 Duplication Syndrome | 1 | ORPHANET | |
| Tgene | C4707092 | Distal 17p13.3 microdeletion syndrome | 1 | ORPHANET |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies