Home

Download

Statistics

Examples

Help

Contact

	Fusion Gene Summary
	Fusion Gene ORF analysis
	Fusion Genomic Features
	Fusion Protein Features
	Fusion Gene Sequence
	Fusion Gene PPI analysis
	Related Drugs
	Related Diseases

Fusion gene:TPM3-ALK (FusionGDB2 ID:HG7170TG238)

Fusion Gene Summary for TPM3-ALK

Fusion gene summary

Fusion gene information	Fusion gene name: TPM3-ALK
	Fusion gene ID: hg7170tg238
		Hgene	Tgene
	Gene symbol	TPM3	ALK
	Gene ID	7170	238
	Gene name	tropomyosin 3	ALK receptor tyrosine kinase
	Synonyms	CAPM1\|CFTD\|HEL-189\|HEL-S-82p\|NEM1\|OK/SW-cl.5\|TM-5\|TM3\|TM30\|TM30nm\|TM5\|TPM3nu\|TPMsk3\|TRK\|hscp30	CD246\|NBLST3
	Cytomap	('TPM3')('ALK') 1q21.3	2p23.2-p23.1
	Type of gene	protein-coding	protein-coding
	Description	tropomyosin alpha-3 chainalpha-tropomyosin, slow skeletalcytoskeletal tropomyosin TM30epididymis luminal protein 189epididymis secretory sperm binding protein Li 82pheat-stable cytoskeletal protein 30 kDatropomyosin 3 nutropomyosin gammatropomyosi	ALK tyrosine kinase receptorCD246 antigenanaplastic lymphoma receptor tyrosine kinasemutant anaplastic lymphoma kinase
	Modification date	20200328	20200329
	UniProtAcc	P06753	Q9UM73
	Ensembl transtripts involved in fusion gene	ENST00000271850, ENST00000302206, ENST00000323144, ENST00000328159, ENST00000330188, ENST00000341372, ENST00000341485, ENST00000368530, ENST00000368531, ENST00000368533, ENST00000469717,
Fusion gene scores	* DoF score	15 X 22 X 8=2640	56 X 74 X 20=82880
	# samples	24	57
	** MAII score	log2(24/2640*10)=-3.4594316186373 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0	log2(57/82880*10)=-7.18391827352181 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0
Context	PubMed: TPM3 [Title/Abstract] AND ALK [Title/Abstract] AND fusion [Title/Abstract]
Most frequent breakpoint	TPM3(154137866)-ALK(29446396), # samples:1 TPM3(154135578)-ALK(30129881), # samples:1 TPM3(154142876)-ALK(29446402), # samples:1
Anticipated loss of major functional domain due to fusion event.	TPM3-ALK seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. TPM3-ALK seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. TPM3-ALK seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. TPM3-ALK seems lost the major protein functional domain in Tgene partner, which is a kinase due to the frame-shifted ORF.

* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Partner	Gene	GO ID	GO term	PubMed ID
Tgene	ALK	GO:0016310	phosphorylation	9174053
Tgene	ALK	GO:0046777	protein autophosphorylation	9174053

Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.

Source	Disease	Sample	Hgene	Hchr	Hbp	Hstrand	Tgene	Tchr	Tbp	Tstrand
ChimerDB4	anaplastic large cell lymphoma;myofibroblastic sarcoma	AF112866	TPM3	chr1	154137866		ALK	chr2	29446396
ChimerKB3	.	.	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
ChimerKB3	.	.	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
ChimerKB3	.	.	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
ChimerKB3	.	.	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
ChiTaRS5.0	N/A	AF112866	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
ChiTaRS5.0	N/A	AF362886	TPM3	chr1	154142876	-	ALK	chr2	29446402	-

Top

Fusion Gene ORF analysis for TPM3-ALK

Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.

ORF	Henst	Tenst	Hgene	Hchr	Hbp	Hstrand	Tgene	Tchr	Tbp	Tstrand
5CDS-intron	ENST00000271850	ENST00000389048	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000271850	ENST00000431873	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000271850	ENST00000431873	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000271850	ENST00000498037	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000271850	ENST00000498037	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000302206	ENST00000389048	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000302206	ENST00000431873	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000302206	ENST00000431873	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000302206	ENST00000498037	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000302206	ENST00000498037	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000323144	ENST00000389048	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000323144	ENST00000431873	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000323144	ENST00000431873	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000323144	ENST00000498037	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000323144	ENST00000498037	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000328159	ENST00000389048	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000328159	ENST00000431873	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000328159	ENST00000431873	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000328159	ENST00000498037	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000328159	ENST00000498037	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000330188	ENST00000389048	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000330188	ENST00000431873	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000330188	ENST00000431873	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000330188	ENST00000498037	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000330188	ENST00000498037	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000341372	ENST00000389048	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000341372	ENST00000431873	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000341372	ENST00000431873	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000341372	ENST00000498037	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000341372	ENST00000498037	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000341485	ENST00000389048	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000341485	ENST00000431873	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000341485	ENST00000431873	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000341485	ENST00000498037	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000341485	ENST00000498037	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000368530	ENST00000389048	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000368530	ENST00000431873	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000368530	ENST00000431873	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000368530	ENST00000498037	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000368530	ENST00000498037	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000368531	ENST00000389048	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000368531	ENST00000431873	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000368531	ENST00000431873	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000368531	ENST00000498037	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000368531	ENST00000498037	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000368533	ENST00000389048	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000368533	ENST00000431873	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000368533	ENST00000431873	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5CDS-intron	ENST00000368533	ENST00000498037	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5CDS-intron	ENST00000368533	ENST00000498037	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5UTR-3CDS	ENST00000469717	ENST00000389048	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5UTR-intron	ENST00000469717	ENST00000389048	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5UTR-intron	ENST00000469717	ENST00000431873	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5UTR-intron	ENST00000469717	ENST00000431873	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
5UTR-intron	ENST00000469717	ENST00000498037	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
5UTR-intron	ENST00000469717	ENST00000498037	TPM3	chr1	154142876	-	ALK	chr2	29446402	-
Frame-shift	ENST00000271850	ENST00000389048	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
Frame-shift	ENST00000323144	ENST00000389048	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
Frame-shift	ENST00000328159	ENST00000389048	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
Frame-shift	ENST00000330188	ENST00000389048	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
Frame-shift	ENST00000341372	ENST00000389048	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
Frame-shift	ENST00000341485	ENST00000389048	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
Frame-shift	ENST00000368530	ENST00000389048	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
Frame-shift	ENST00000368531	ENST00000389048	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
Frame-shift	ENST00000368533	ENST00000389048	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
In-frame	ENST00000302206	ENST00000389048	TPM3	chr1	154143124	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000271850	ENST00000389048	TPM3	chr1	154137866		ALK	chr2	29446396
intron-3CDS	ENST00000271850	ENST00000389048	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000271850	ENST00000389048	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000271850	ENST00000389048	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-3CDS	ENST00000302206	ENST00000389048	TPM3	chr1	154137866		ALK	chr2	29446396
intron-3CDS	ENST00000302206	ENST00000389048	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000302206	ENST00000389048	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000302206	ENST00000389048	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-3CDS	ENST00000323144	ENST00000389048	TPM3	chr1	154137866		ALK	chr2	29446396
intron-3CDS	ENST00000323144	ENST00000389048	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000323144	ENST00000389048	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000323144	ENST00000389048	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-3CDS	ENST00000328159	ENST00000389048	TPM3	chr1	154137866		ALK	chr2	29446396
intron-3CDS	ENST00000328159	ENST00000389048	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000328159	ENST00000389048	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000328159	ENST00000389048	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-3CDS	ENST00000330188	ENST00000389048	TPM3	chr1	154137866		ALK	chr2	29446396
intron-3CDS	ENST00000330188	ENST00000389048	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000330188	ENST00000389048	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000330188	ENST00000389048	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-3CDS	ENST00000341372	ENST00000389048	TPM3	chr1	154137866		ALK	chr2	29446396
intron-3CDS	ENST00000341372	ENST00000389048	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000341372	ENST00000389048	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000341372	ENST00000389048	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-3CDS	ENST00000341485	ENST00000389048	TPM3	chr1	154137866		ALK	chr2	29446396
intron-3CDS	ENST00000341485	ENST00000389048	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000341485	ENST00000389048	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000341485	ENST00000389048	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-3CDS	ENST00000368530	ENST00000389048	TPM3	chr1	154137866		ALK	chr2	29446396
intron-3CDS	ENST00000368530	ENST00000389048	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000368530	ENST00000389048	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000368530	ENST00000389048	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-3CDS	ENST00000368531	ENST00000389048	TPM3	chr1	154137866		ALK	chr2	29446396
intron-3CDS	ENST00000368531	ENST00000389048	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000368531	ENST00000389048	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000368531	ENST00000389048	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-3CDS	ENST00000368533	ENST00000389048	TPM3	chr1	154137866		ALK	chr2	29446396
intron-3CDS	ENST00000368533	ENST00000389048	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000368533	ENST00000389048	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000368533	ENST00000389048	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-3CDS	ENST00000469717	ENST00000389048	TPM3	chr1	154137866		ALK	chr2	29446396
intron-3CDS	ENST00000469717	ENST00000389048	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000469717	ENST00000389048	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-3CDS	ENST00000469717	ENST00000389048	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000271850	ENST00000389048	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000271850	ENST00000431873	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000271850	ENST00000431873	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000271850	ENST00000431873	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000271850	ENST00000431873	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000271850	ENST00000431873	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000271850	ENST00000498037	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000271850	ENST00000498037	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000271850	ENST00000498037	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000271850	ENST00000498037	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000271850	ENST00000498037	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000302206	ENST00000389048	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000302206	ENST00000431873	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000302206	ENST00000431873	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000302206	ENST00000431873	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000302206	ENST00000431873	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000302206	ENST00000431873	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000302206	ENST00000498037	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000302206	ENST00000498037	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000302206	ENST00000498037	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000302206	ENST00000498037	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000302206	ENST00000498037	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000323144	ENST00000389048	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000323144	ENST00000431873	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000323144	ENST00000431873	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000323144	ENST00000431873	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000323144	ENST00000431873	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000323144	ENST00000431873	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000323144	ENST00000498037	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000323144	ENST00000498037	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000323144	ENST00000498037	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000323144	ENST00000498037	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000323144	ENST00000498037	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000328159	ENST00000389048	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000328159	ENST00000431873	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000328159	ENST00000431873	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000328159	ENST00000431873	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000328159	ENST00000431873	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000328159	ENST00000431873	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000328159	ENST00000498037	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000328159	ENST00000498037	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000328159	ENST00000498037	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000328159	ENST00000498037	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000328159	ENST00000498037	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000330188	ENST00000389048	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000330188	ENST00000431873	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000330188	ENST00000431873	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000330188	ENST00000431873	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000330188	ENST00000431873	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000330188	ENST00000431873	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000330188	ENST00000498037	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000330188	ENST00000498037	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000330188	ENST00000498037	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000330188	ENST00000498037	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000330188	ENST00000498037	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000341372	ENST00000389048	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000341372	ENST00000431873	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000341372	ENST00000431873	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000341372	ENST00000431873	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000341372	ENST00000431873	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000341372	ENST00000431873	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000341372	ENST00000498037	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000341372	ENST00000498037	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000341372	ENST00000498037	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000341372	ENST00000498037	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000341372	ENST00000498037	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000341485	ENST00000389048	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000341485	ENST00000431873	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000341485	ENST00000431873	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000341485	ENST00000431873	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000341485	ENST00000431873	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000341485	ENST00000431873	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000341485	ENST00000498037	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000341485	ENST00000498037	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000341485	ENST00000498037	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000341485	ENST00000498037	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000341485	ENST00000498037	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000368530	ENST00000389048	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000368530	ENST00000431873	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000368530	ENST00000431873	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000368530	ENST00000431873	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000368530	ENST00000431873	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000368530	ENST00000431873	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000368530	ENST00000498037	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000368530	ENST00000498037	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000368530	ENST00000498037	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000368530	ENST00000498037	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000368530	ENST00000498037	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000368531	ENST00000389048	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000368531	ENST00000431873	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000368531	ENST00000431873	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000368531	ENST00000431873	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000368531	ENST00000431873	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000368531	ENST00000431873	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000368531	ENST00000498037	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000368531	ENST00000498037	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000368531	ENST00000498037	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000368531	ENST00000498037	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000368531	ENST00000498037	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000368533	ENST00000389048	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000368533	ENST00000431873	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000368533	ENST00000431873	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000368533	ENST00000431873	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000368533	ENST00000431873	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000368533	ENST00000431873	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000368533	ENST00000498037	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000368533	ENST00000498037	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000368533	ENST00000498037	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000368533	ENST00000498037	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000368533	ENST00000498037	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000469717	ENST00000389048	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000469717	ENST00000431873	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000469717	ENST00000431873	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000469717	ENST00000431873	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000469717	ENST00000431873	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000469717	ENST00000431873	TPM3	chr1	154135578	-	ALK	chr2	30129881	-
intron-intron	ENST00000469717	ENST00000498037	TPM3	chr1	154137866		ALK	chr2	29446396
intron-intron	ENST00000469717	ENST00000498037	TPM3	chr1	154131444	-	ALK	chr2	29446394	-
intron-intron	ENST00000469717	ENST00000498037	TPM3	chr1	154134289	-	ALK	chr2	29446394	-
intron-intron	ENST00000469717	ENST00000498037	TPM3	chr1	154144580	-	ALK	chr2	29446307	-
intron-intron	ENST00000469717	ENST00000498037	TPM3	chr1	154135578	-	ALK	chr2	30129881	-

ORFfinder result based on the fusion transcript sequence of in-frame fusion genes.

Henst

Tenst

Hgene

Hchr

Hbp

Hstrand

Tgene

Tchr

Tbp

Tstrand

Seq length
(transcript)

BP loci
(transcript)

Predicted start
(transcript)

Predicted stop
(transcript)

Seq length
(amino acids)

ENST00000302206

TPM3

chr1

154143124

ENST00000389048

ALK

chr2

29446394

2673

532

555

2222

555

DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated.

Henst

Tenst

Hgene

Hchr

Hbp

Hstrand

Tgene

Tchr

Tbp

Tstrand

No-coding score

Coding score

Top

Fusion Genomic Features for TPM3-ALK

FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints.

Hgene

Hchr

Hbp

Hstrand

Tgene

Tchr

Tbp

Tstrand

1-p

p (fusion gene breakpoint)

Top

Fusion Protein Features for TPM3-ALK

Four levels of functional features of fusion genes
Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:154137866/chr2:29446396)
- FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels.
- How to search
1. Put your fusion gene symbol.
2. Press the tab key until there will be shown the breakpoint information filled.
4. Go down and press 'Search' tab twice.
4. Go down to have the hyperlink of the search result.
5. Click the hyperlink.
6. See the FGviewer result for your fusion gene.

Main function of each fusion partner protein. (from UniProt)

Hgene	Tgene
TPM3 P06753	ALK Q9UM73
FUNCTION: Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments. {ECO:0000250\|UniProtKB:P09493}.	FUNCTION: Neuronal receptor tyrosine kinase that is essentially and transiently expressed in specific regions of the central and peripheral nervous systems and plays an important role in the genesis and differentiation of the nervous system. Transduces signals from ligands at the cell surface, through specific activation of the mitogen-activated protein kinase (MAPK) pathway. Phosphorylates almost exclusively at the first tyrosine of the Y-x-x-x-Y-Y motif. Following activation by ligand, ALK induces tyrosine phosphorylation of CBL, FRS2, IRS1 and SHC1, as well as of the MAP kinases MAPK1/ERK2 and MAPK3/ERK1. Acts as a receptor for ligands pleiotrophin (PTN), a secreted growth factor, and midkine (MDK), a PTN-related factor, thus participating in PTN and MDK signal transduction. PTN-binding induces MAPK pathway activation, which is important for the anti-apoptotic signaling of PTN and regulation of cell proliferation. MDK-binding induces phosphorylation of the ALK target insulin receptor substrate (IRS1), activates mitogen-activated protein kinases (MAPKs) and PI3-kinase, resulting also in cell proliferation induction. Drives NF-kappa-B activation, probably through IRS1 and the activation of the AKT serine/threonine kinase. Recruitment of IRS1 to activated ALK and the activation of NF-kappa-B are essential for the autocrine growth and survival signaling of MDK. Thinness gene involved in the resistance to weight gain: in hypothalamic neurons, controls energy expenditure acting as a negative regulator of white adipose tissue lipolysis and sympathetic tone to fine-tune energy homeostasis (By similarity). {ECO:0000250\|UniProtKB:P97793, ECO:0000269\|PubMed:11121404, ECO:0000269\|PubMed:11278720, ECO:0000269\|PubMed:11387242, ECO:0000269\|PubMed:11809760, ECO:0000269\|PubMed:12107166, ECO:0000269\|PubMed:12122009, ECO:0000269\|PubMed:15226403, ECO:0000269\|PubMed:15908427, ECO:0000269\|PubMed:16317043, ECO:0000269\|PubMed:16878150, ECO:0000269\|PubMed:17274988}.

Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at
download page

* Minus value of BPloci means that the break pointn is located before the CDS.

- In-frame and retained protein feature among the 13 regional features.

Partner

Gene

Hbp

Tbp

ENST

Strand

BPexon

TotalExon

Protein feature loci

*BPloci

TotalLen

Protein feature

Protein feature note

- In-frame and not-retained protein feature among the 13 regional features.

Partner

Gene

Hbp

Tbp

ENST

Strand

BPexon

TotalExon

Protein feature loci

*BPloci

TotalLen

Protein feature

Protein feature note

Top

Fusion Gene Sequence for TPM3-ALK

For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones.

>93374_93374_1_TPM3-ALK_TPM3_chr1_154143124_ENST00000302206_ALK_chr2_29446394_ENST00000389048_length(transcript)=2673nt_BP=532nt
GGTGAGCTGCATGATGTCTTACATTTCATGAGCTTCCTCTAAATCTAGTTGTATTTTTCGTCTGAGGGGGGCTGAGGCTGAGGTGGCCTC
CTTGAACCGTAGGATCCAGCTGGTTGAAGAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGA
AAAAGCTGCTGATGAGAGTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCA
ACTCAAAGAAGCTAAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGA
ACGCACAGAGGAACGAGCTGAGCTGGCAGAGTCTAAGTGTTCTGAGCTGGAGGAGGAGCTGAAGAATGTCACCAACAACCTCAAGTCTCT
TGAGGCTCAGGCGGAGAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGTGTACCGC
CGGAAGCACCAGGAGCTGCAAGCCATGCAGATGGAGCTGCAGAGCCCTGAGTACAAGCTGAGCAAGCTCCGCACCTCGACCATCATGACC
GACTACAACCCCAACTACTGCTTTGCTGGCAAGACCTCCTCCATCAGTGACCTGAAGGAGGTGCCGCGGAAAAACATCACCCTCATTCGG
GGTCTGGGCCATGGCGCCTTTGGGGAGGTGTATGAAGGCCAGGTGTCCGGAATGCCCAACGACCCAAGCCCCCTGCAAGTGGCTGTGAAG
ACGCTGCCTGAAGTGTGCTCTGAACAGGACGAACTGGATTTCCTCATGGAAGCCCTGATCATCAGCAAATTCAACCACCAGAACATTGTT
CGCTGCATTGGGGTGAGCCTGCAATCCCTGCCCCGGTTCATCCTGCTGGAGCTCATGGCGGGGGGAGACCTCAAGTCCTTCCTCCGAGAG
ACCCGCCCTCGCCCGAGCCAGCCCTCCTCCCTGGCCATGCTGGACCTTCTGCACGTGGCTCGGGACATTGCCTGTGGCTGTCAGTATTTG
GAGGAAAACCACTTCATCCACCGAGACATTGCTGCCAGAAACTGCCTCTTGACCTGTCCAGGCCCTGGAAGAGTGGCCAAGATTGGAGAC
TTCGGGATGGCCCGAGACATCTACAGGGCGAGCTACTATAGAAAGGGAGGCTGTGCCATGCTGCCAGTTAAGTGGATGCCCCCAGAGGCC
TTCATGGAAGGAATATTCACTTCTAAAACAGACACATGGTCCTTTGGAGTGCTGCTATGGGAAATCTTTTCTCTTGGATATATGCCATAC
CCCAGCAAAAGCAACCAGGAAGTTCTGGAGTTTGTCACCAGTGGAGGCCGGATGGACCCACCCAAGAACTGCCCTGGGCCTGTATACCGG
ATAATGACTCAGTGCTGGCAACATCAGCCTGAAGACAGGCCCAACTTTGCCATCATTTTGGAGAGGATTGAATACTGCACCCAGGACCCG
GATGTAATCAACACCGCTTTGCCGATAGAATATGGTCCACTTGTGGAAGAGGAAGAGAAAGTGCCTGTGAGGCCCAAGGACCCTGAGGGG
GTTCCTCCTCTCCTGGTCTCTCAACAGGCAAAACGGGAGGAGGAGCGCAGCCCAGCTGCCCCACCACCTCTGCCTACCACCTCCTCTGGC
AAGGCTGCAAAGAAACCCACAGCTGCAGAGATCTCTGTTCGAGTCCCTAGAGGGCCGGCCGTGGAAGGGGGACACGTGAATATGGCATTC
TCTCAGTCCAACCCTCCTTCGGAGTTGCACAAGGTCCACGGATCCAGAAACAAGCCCACCAGCTTGTGGAACCCAACGTACGGCTCCTGG
TTTACAGAGAAACCCACCAAAAAGAATAATCCTATAGCAAAGAAGGAGCCACACGACAGGGGTAACCTGGGGCTGGAGGGAAGCTGTACT
GTCCCACCTAACGTTGCAACTGGGAGACTTCCGGGGGCCTCACTGCTCCTAGAGCCCTCTTCGCTGACTGCCAATATGAAGGAGGTACCT
CTGTTCAGGCTACGTCACTTCCCTTGTGGGAATGTCAATTACGGCTACCAGCAACAGGGCTTGCCCTTAGAAGCCGCTACTGCCCCTGGA
GCTGGTCATTACGAGGATACCATTCTGAAAAGCAAGAATAGCATGAACCAGCCTGGGCCCTGAGCTCGGTCGCACACTCACTTCTCTTCC
TTGGGATCCCTAAGACCGTGGAGGAGAGAGAGGCAATGGCTCCTTCACAAACCAGAGACCAAATGTCACGTTTTGTTTTGTGCCAACCTA
TTTTGAAGTACCACCAAAAAAGCTGTATTTTGAAAATGCTTTAGAAAGGTTTTGAGCATGGGTTCATCCTATTCTTTCGAAAGAAGAAAA
TATCATAAAAATGAGTGATAAATACAAGGCCCAGATGTGGTTGCATAAGGTTTTTATGCATGTTTGTTGTATACTTCCTTATGCTTCTTT
CAAATTGTGTGTGCTCTGCTTCAATGTAGTCAGAATTAGCTGCTTCTATGTTTCATAGTTGGGGTCATAGATGTTTCCTTGCCTTGTTGA

>93374_93374_1_TPM3-ALK_TPM3_chr1_154143124_ENST00000302206_ALK_chr2_29446394_ENST00000389048_length(amino acids)=555AA_BP=
MQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEV
CSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHF
IHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSN
QEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLL
VSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKP
TKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYE

--------------------------------------------------------------

Top

Fusion Gene PPI Analysis for TPM3-ALK

Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in
ChiPPI page.

Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)

Hgene

Hgene's interactors

Tgene

Tgene's interactors

- Retained PPIs in in-frame fusion.

Partner

Gene

Hbp

Tbp

ENST

Strand

BPexon

TotalExon

Protein feature loci

*BPloci

TotalLen

Still interaction with

- Lost PPIs in in-frame fusion.

Partner

Gene

Hbp

Tbp

ENST

Strand

BPexon

TotalExon

Protein feature loci

*BPloci

TotalLen

Interaction lost with

- Retained PPIs, but lost function due to frame-shift fusion.

Partner

Gene

Hbp

Tbp

ENST

Strand

BPexon

TotalExon

Protein feature loci

*BPloci

TotalLen

Interaction lost with

Top

Related Drugs for TPM3-ALK

Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.8 2021-05-08)

Partner	Gene	UniProtAcc	DrugBank ID	Drug name	Drug activity	Drug type	Drug status
Tgene	ALK	Q9UM73	DB08865	Crizotinib	Inhibitor	Small molecule	Approved
Tgene	ALK	Q9UM73	DB09063	Ceritinib	Antagonist	Small molecule	Approved
Tgene	ALK	Q9UM73	DB11363	Alectinib	Inhibitor	Small molecule	Approved\|Investigational
Tgene	ALK	Q9UM73	DB12010	Fostamatinib	Inhibitor	Small molecule	Approved\|Investigational
Tgene	ALK	Q9UM73	DB12130	Lorlatinib	Inhibitor	Small molecule	Approved\|Investigational
Tgene	ALK	Q9UM73	DB12141	Gilteritinib	Inhibitor	Small molecule	Approved\|Investigational
Tgene	ALK	Q9UM73	DB12267	Brigatinib	Inhibitor	Small molecule	Approved\|Investigational

Top

Related Diseases for TPM3-ALK

Diseases associated with fusion partners.
(DisGeNet 4.0)

Partner	Gene	Disease ID	Disease name	# pubmeds	Source
Hgene	TPM3	C1836448	Nemaline myopathy 1	9	CTD_human;GENOMICS_ENGLAND;UNIPROT
Hgene	TPM3	C0546264	Congenital Fiber Type Disproportion	4	CTD_human;GENOMICS_ENGLAND;UNIPROT
Hgene	TPM3	C0007097	Carcinoma	2	CTD_human
Hgene	TPM3	C0024667	Animal Mammary Neoplasms	2	CTD_human
Hgene	TPM3	C0024668	Mammary Neoplasms, Experimental	2	CTD_human
Hgene	TPM3	C0205696	Anaplastic carcinoma	2	CTD_human
Hgene	TPM3	C0205697	Carcinoma, Spindle-Cell	2	CTD_human
Hgene	TPM3	C0205698	Undifferentiated carcinoma	2	CTD_human
Hgene	TPM3	C0205699	Carcinomatosis	2	CTD_human
Hgene	TPM3	C0206157	Myopathies, Nemaline	2	GENOMICS_ENGLAND
Hgene	TPM3	C1257925	Mammary Carcinoma, Animal	2	CTD_human
Hgene	TPM3	C0001418	Adenocarcinoma	1	CTD_human
Hgene	TPM3	C0007102	Malignant tumor of colon	1	CTD_human
Hgene	TPM3	C0009375	Colonic Neoplasms	1	CTD_human
Hgene	TPM3	C0023893	Liver Cirrhosis, Experimental	1	CTD_human
Hgene	TPM3	C0024623	Malignant neoplasm of stomach	1	CTD_human
Hgene	TPM3	C0038356	Stomach Neoplasms	1	CTD_human
Hgene	TPM3	C0040136	Thyroid Neoplasm	1	CTD_human
Hgene	TPM3	C0151468	Thyroid Gland Follicular Adenoma	1	CTD_human
Hgene	TPM3	C0205641	Adenocarcinoma, Basal Cell	1	CTD_human
Hgene	TPM3	C0205642	Adenocarcinoma, Oxyphilic	1	CTD_human
Hgene	TPM3	C0205643	Carcinoma, Cribriform	1	CTD_human
Hgene	TPM3	C0205644	Carcinoma, Granular Cell	1	CTD_human
Hgene	TPM3	C0205645	Adenocarcinoma, Tubular	1	CTD_human
Hgene	TPM3	C0270960	Congenital myopathy (disorder)	1	GENOMICS_ENGLAND
Hgene	TPM3	C0334121	Inflammatory Myofibroblastic Tumor	1	ORPHANET
Hgene	TPM3	C0546125	Nemaline Myopathy, Childhood Onset	1	ORPHANET
Hgene	TPM3	C0549473	Thyroid carcinoma	1	CTD_human
Hgene	TPM3	C1708349	Hereditary Diffuse Gastric Cancer	1	CTD_human
Hgene	TPM3	C3710589	Cap Myopathy	1	ORPHANET
Tgene		C0007131	Non-Small Cell Lung Carcinoma	28	CGI;CTD_human
Tgene		C0027819	Neuroblastoma	13	CGI;CTD_human;ORPHANET
Tgene		C0152013	Adenocarcinoma of lung (disorder)	8	CGI;CTD_human
Tgene		C2751681	NEUROBLASTOMA, SUSCEPTIBILITY TO, 3	8	CLINGEN;UNIPROT
Tgene		C0206180	Ki-1+ Anaplastic Large Cell Lymphoma	6	CGI;CTD_human
Tgene		C0334121	Inflammatory Myofibroblastic Tumor	4	CGI;CTD_human;ORPHANET
Tgene		C0018199	Granuloma, Plasma Cell	3	CTD_human
Tgene		C0007621	Neoplastic Cell Transformation	2	CTD_human
Tgene		C0027627	Neoplasm Metastasis	2	CTD_human
Tgene		C0238463	Papillary thyroid carcinoma	2	ORPHANET
Tgene		C0001973	Alcoholic Intoxication, Chronic	1	PSYGENET
Tgene		C0006118	Brain Neoplasms	1	CGI;CTD_human
Tgene		C0006142	Malignant neoplasm of breast	1	CTD_human
Tgene		C0007134	Renal Cell Carcinoma	1	CTD_human
Tgene		C0011570	Mental Depression	1	PSYGENET
Tgene		C0011581	Depressive disorder	1	PSYGENET
Tgene		C0027643	Neoplasm Recurrence, Local	1	CTD_human
Tgene		C0036341	Schizophrenia	1	PSYGENET
Tgene		C0079744	Diffuse Large B-Cell Lymphoma	1	CTD_human
Tgene		C0085269	Plasma Cell Granuloma, Pulmonary	1	CTD_human
Tgene		C0153633	Malignant neoplasm of brain	1	CGI;CTD_human
Tgene		C0278601	Inflammatory Breast Carcinoma	1	CTD_human
Tgene		C0279702	Conventional (Clear Cell) Renal Cell Carcinoma	1	CTD_human
Tgene		C0496899	Benign neoplasm of brain, unspecified	1	CTD_human
Tgene		C0678222	Breast Carcinoma	1	CTD_human
Tgene		C0750974	Brain Tumor, Primary	1	CTD_human
Tgene		C0750977	Recurrent Brain Neoplasm	1	CTD_human
Tgene		C0750979	Primary malignant neoplasm of brain	1	CTD_human
Tgene		C1257931	Mammary Neoplasms, Human	1	CTD_human
Tgene		C1266042	Chromophobe Renal Cell Carcinoma	1	CTD_human
Tgene		C1266043	Sarcomatoid Renal Cell Carcinoma	1	CTD_human
Tgene		C1266044	Collecting Duct Carcinoma of the Kidney	1	CTD_human
Tgene		C1306837	Papillary Renal Cell Carcinoma	1	CTD_human
Tgene		C1332079	Anaplastic Large Cell Lymphoma, ALK-Positive	1	ORPHANET
Tgene		C1458155	Mammary Neoplasms	1	CTD_human
Tgene		C1527390	Neoplasms, Intracranial	1	CTD_human
Tgene		C2931189	Neural crest tumor	1	ORPHANET
Tgene		C3899155	hereditary neuroblastoma	1	GENOMICS_ENGLAND
Tgene		C4704874	Mammary Carcinoma, Human	1	CTD_human

Fusion Gene Studies in Kim Lab

Fusion gene:TPM3-ALK (FusionGDB2 ID:HG7170TG238)

Fusion Gene Summary for TPM3-ALK

Fusion Gene ORF analysis for TPM3-ALK

Fusion Genomic Features for TPM3-ALK

Fusion Protein Features for TPM3-ALK

Fusion Gene Sequence for TPM3-ALK

Fusion Gene PPI Analysis for TPM3-ALK

Related Drugs for TPM3-ALK

Related Diseases for TPM3-ALK

Fusion Gene Studies
in Kim Lab