![]() |
||||||
|
![]() | Fusion Gene Summary |
![]() | Fusion Gene ORF analysis |
![]() | Fusion Genomic Features |
![]() | Fusion Protein Features |
![]() | Fusion Gene Sequence |
![]() | Fusion Gene PPI analysis |
![]() | Related Drugs |
![]() | Related Diseases |
Fusion gene:GAS6-GPC5 (FusionGDB2 ID:HG2621TG2262) |
Fusion Gene Summary for GAS6-GPC5 |
![]() |
Fusion gene information | Fusion gene name: GAS6-GPC5 | Fusion gene ID: hg2621tg2262 | Hgene | Tgene | Gene symbol | GAS6 | GPC5 | Gene ID | 2621 | 2262 |
Gene name | growth arrest specific 6 | glypican 5 | |
Synonyms | AXLLG|AXSF | - | |
Cytomap | ('GAS6')('GPC5') 13q34 | 13q31.3 | |
Type of gene | protein-coding | protein-coding | |
Description | growth arrest-specific protein 6AXL receptor tyrosine kinase ligandAXL stimulatory factor | glypican-5bA93M14.1glypican proteoglycan 5 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | . | P78333 | |
Ensembl transtripts involved in fusion gene | ENST00000327773, ENST00000357389, ENST00000476291, ENST00000355761, ENST00000418959, ENST00000450766, | ||
Fusion gene scores | * DoF score | 21 X 12 X 12=3024 | 18 X 14 X 8=2016 |
# samples | 29 | 20 | |
** MAII score | log2(29/3024*10)=-3.38233333420614 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(20/2016*10)=-3.33342373372519 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: GAS6 [Title/Abstract] AND GPC5 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | GAS6(114566548)-GPC5(93518535), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | GAS6-GPC5 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. GAS6-GPC5 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | GAS6 | GO:0001934 | positive regulation of protein phosphorylation | 7854420|16723520|20103767 |
Hgene | GAS6 | GO:0006468 | protein phosphorylation | 16359517 |
Hgene | GAS6 | GO:0006909 | phagocytosis | 21501828 |
Hgene | GAS6 | GO:0007165 | signal transduction | 7854420|18680538 |
Hgene | GAS6 | GO:0010628 | positive regulation of gene expression | 19657094 |
Hgene | GAS6 | GO:0010804 | negative regulation of tumor necrosis factor-mediated signaling pathway | 19657094 |
Hgene | GAS6 | GO:0018105 | peptidyl-serine phosphorylation | 18680538|20103767 |
Hgene | GAS6 | GO:0019064 | fusion of virus membrane with host plasma membrane | 21501828 |
Hgene | GAS6 | GO:0019079 | viral genome replication | 21501828 |
Hgene | GAS6 | GO:0032689 | negative regulation of interferon-gamma production | 18840707 |
Hgene | GAS6 | GO:0032715 | negative regulation of interleukin-6 production | 19657094 |
Hgene | GAS6 | GO:0032720 | negative regulation of tumor necrosis factor production | 19657094|20103767 |
Hgene | GAS6 | GO:0032825 | positive regulation of natural killer cell differentiation | 18840707 |
Hgene | GAS6 | GO:0033138 | positive regulation of peptidyl-serine phosphorylation | 16723520 |
Hgene | GAS6 | GO:0035457 | cellular response to interferon-alpha | 19657094 |
Hgene | GAS6 | GO:0035690 | cellular response to drug | 16359517 |
Hgene | GAS6 | GO:0035754 | B cell chemotaxis | 19922767 |
Hgene | GAS6 | GO:0043066 | negative regulation of apoptotic process | 19922767 |
Hgene | GAS6 | GO:0043154 | negative regulation of cysteine-type endopeptidase activity involved in apoptotic process | 16723520 |
Hgene | GAS6 | GO:0043277 | apoptotic cell clearance | 21501828 |
Hgene | GAS6 | GO:0043433 | negative regulation of DNA-binding transcription factor activity | 18680538 |
Hgene | GAS6 | GO:0043491 | protein kinase B signaling | 16723520|20103767 |
Hgene | GAS6 | GO:0045860 | positive regulation of protein kinase activity | 7854420 |
Hgene | GAS6 | GO:0045892 | negative regulation of transcription, DNA-templated | 18680538 |
Hgene | GAS6 | GO:0046718 | viral entry into host cell | 21501828 |
Hgene | GAS6 | GO:0046813 | receptor-mediated virion attachment to host cell | 21501828 |
Hgene | GAS6 | GO:0046827 | positive regulation of protein export from nucleus | 18680538 |
Hgene | GAS6 | GO:0048146 | positive regulation of fibroblast proliferation | 7854420|15184064 |
Hgene | GAS6 | GO:0050711 | negative regulation of interleukin-1 secretion | 20103767 |
Hgene | GAS6 | GO:0050766 | positive regulation of phagocytosis | 18395422 |
Hgene | GAS6 | GO:0051897 | positive regulation of protein kinase B signaling | 16359517|16723520|18680538 |
Hgene | GAS6 | GO:0061098 | positive regulation of protein tyrosine kinase activity | 20103767 |
Hgene | GAS6 | GO:0070168 | negative regulation of biomineral tissue development | 20048160 |
Hgene | GAS6 | GO:0070374 | positive regulation of ERK1 and ERK2 cascade | 15184064 |
Hgene | GAS6 | GO:0070588 | calcium ion transmembrane transport | 18395422 |
Hgene | GAS6 | GO:0071307 | cellular response to vitamin K | 16359517 |
Hgene | GAS6 | GO:0072659 | protein localization to plasma membrane | 16359517 |
Hgene | GAS6 | GO:0097241 | hematopoietic stem cell migration to bone marrow | 19922767 |
Hgene | GAS6 | GO:1900142 | negative regulation of oligodendrocyte apoptotic process | 16723520 |
Hgene | GAS6 | GO:1900165 | negative regulation of interleukin-6 secretion | 20103767 |
Hgene | GAS6 | GO:2000270 | negative regulation of fibroblast apoptotic process | 16359517 |
Hgene | GAS6 | GO:2000352 | negative regulation of endothelial cell apoptotic process | 16359517|18680538|18760998 |
Hgene | GAS6 | GO:2000510 | positive regulation of dendritic cell chemotaxis | 19657094 |
Hgene | GAS6 | GO:2000669 | negative regulation of dendritic cell apoptotic process | 19657094 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LUAD | TCGA-O1-A52J-01A | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
Top |
Fusion Gene ORF analysis for GAS6-GPC5 |
![]() * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000327773 | ENST00000483422 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
5CDS-intron | ENST00000357389 | ENST00000483422 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
5UTR-3CDS | ENST00000476291 | ENST00000377067 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
5UTR-intron | ENST00000476291 | ENST00000483422 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
In-frame | ENST00000327773 | ENST00000377067 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
In-frame | ENST00000357389 | ENST00000377067 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
intron-3CDS | ENST00000355761 | ENST00000377067 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
intron-3CDS | ENST00000418959 | ENST00000377067 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
intron-3CDS | ENST00000450766 | ENST00000377067 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
intron-intron | ENST00000355761 | ENST00000483422 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
intron-intron | ENST00000418959 | ENST00000483422 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
intron-intron | ENST00000450766 | ENST00000483422 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000357389 | GAS6 | chr13 | 114566548 | - | ENST00000377067 | GPC5 | chr13 | 93518535 | + | 1364 | 408 | 432 | 1 | 144 |
ENST00000327773 | GAS6 | chr13 | 114566548 | - | ENST00000377067 | GPC5 | chr13 | 93518535 | + | 1358 | 402 | 426 | 1 | 142 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000357389 | ENST00000377067 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + | 0.06725784 | 0.9327421 |
ENST00000327773 | ENST00000377067 | GAS6 | chr13 | 114566548 | - | GPC5 | chr13 | 93518535 | + | 0.046932377 | 0.95306766 |
Top |
Fusion Genomic Features for GAS6-GPC5 |
![]() |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
GAS6 | chr13 | 114566547 | - | GPC5 | chr13 | 93518534 | + | 3.32E-07 | 0.99999964 |
GAS6 | chr13 | 114566547 | - | GPC5 | chr13 | 93518534 | + | 3.32E-07 | 0.99999964 |
![]() |
![]() |
![]() |
![]() |
Top |
Fusion Protein Features for GAS6-GPC5 |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr13:114566548/chr13:93518535) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | GPC5 |
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. | FUNCTION: Cell surface proteoglycan that bears heparan sulfate. {ECO:0000250}. |
![]() * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 116_154 | 85 | 679.0 | Domain | EGF-like 1%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 156_196 | 85 | 679.0 | Domain | EGF-like 2%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 197_237 | 85 | 679.0 | Domain | EGF-like 3%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 238_278 | 85 | 679.0 | Domain | EGF-like 4%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 298_470 | 85 | 679.0 | Domain | Laminin G-like 1 |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 477_670 | 85 | 679.0 | Domain | Laminin G-like 2 |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000327773 | - | 2 | 15 | 53_94 | 85 | 679.0 | Domain | Gla |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 116_154 | 0 | 625.0 | Domain | EGF-like 1%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 156_196 | 0 | 625.0 | Domain | EGF-like 2%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 197_237 | 0 | 625.0 | Domain | EGF-like 3%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 238_278 | 0 | 625.0 | Domain | EGF-like 4%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 298_470 | 0 | 625.0 | Domain | Laminin G-like 1 |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 477_670 | 0 | 625.0 | Domain | Laminin G-like 2 |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000355761 | - | 1 | 13 | 53_94 | 0 | 625.0 | Domain | Gla |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 116_154 | 0 | 380.0 | Domain | EGF-like 1%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 156_196 | 0 | 380.0 | Domain | EGF-like 2%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 197_237 | 0 | 380.0 | Domain | EGF-like 3%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 238_278 | 0 | 380.0 | Domain | EGF-like 4%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 298_470 | 0 | 380.0 | Domain | Laminin G-like 1 |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 477_670 | 0 | 380.0 | Domain | Laminin G-like 2 |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000418959 | - | 1 | 7 | 53_94 | 0 | 380.0 | Domain | Gla |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 116_154 | 0 | 406.0 | Domain | EGF-like 1%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 156_196 | 0 | 406.0 | Domain | EGF-like 2%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 197_237 | 0 | 406.0 | Domain | EGF-like 3%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 238_278 | 0 | 406.0 | Domain | EGF-like 4%3B calcium-binding |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 298_470 | 0 | 406.0 | Domain | Laminin G-like 1 |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 477_670 | 0 | 406.0 | Domain | Laminin G-like 2 |
Hgene | GAS6 | chr13:114566548 | chr13:93518535 | ENST00000450766 | - | 1 | 9 | 53_94 | 0 | 406.0 | Domain | Gla |
Top |
Fusion Gene Sequence for GAS6-GPC5 |
![]() |
>32532_32532_1_GAS6-GPC5_GAS6_chr13_114566548_ENST00000327773_GPC5_chr13_93518535_ENST00000377067_length(transcript)=1358nt_BP=402nt GCTTGAGGTGCCGCAGCCGCCGCCGCCGCCGCCGCCGCGATGTGACCTTCAGGGCCGCCAGGACGGGATGACCGGAGCCTCCGCCCCGCG GCGCCCGCGGCTCGCCTCGGCCTCCCGGGCGCTCTGACCGCGCGTCCCCGGCCCGCCATGGCCCCTTCGCTCTCGCCCGGGCCCGCCGCC CTGCGCCGCGCGCCGCAGCTGCTGCTGCTGCTGCTGGCCGCGGAGTGCGCGCTTGCCGCGCTGTTGCCGGCGCGCGAGGCCACGCAGTTC CTGCGGCCCAGGCAGCGCCGCGCCTTTCAGGTCTTCGAGGAGGCCAAGCAGGGCCACCTGGAGAGGGAGTGCGTGGAGGAGCTGTGCAGC CGCGAGGAGGCGCGGGAGGTGTTCGAGAACGACCCCGAGACGGGATGCCAGATGATATGAACTTCAGTGATGTAAAGCAAATCCATCAAA CAGACACTGGCAGTACTTTAGACACAACAGGAGCAGGATGTGCAGTGGCGACTGAATCTATGACATTCACTCTGATAAGTGTGGTGATGT TACTTCCCGGGATTTGGTAACTGAACTCTTCTGTCCTGACATACCTTACTGAAGTCTCGATTTCTTCTCTCTCTGCATATGCCTGGAATA AGAGATCCTTTTTCAATGTAACAATTATATTTATGAAAAGATATGTTACACTAACTTCTCAGAAGCCAAGCTGAAATATTCATAAAGTCC CTAAAACTCAACGTTTAAATGACACACTTTAAAAATATGTCTTTTTTCAATCTAACTGAAAACCTTCTTAACTTCTAATATATTAAATCT GAAGATGTGAAGGGCACAGAAGTGACTTTGAATAAGAAGAATTTAGTGTATCTGTAATTTTATTATCAATTCCAAGCCCCTTCCTTTCTA AATTAAAAATGTTTTCATTTGAAAGTGTATTTGCCAGACAATGAAAACAGTATGCAGTATTTCTTAAAGTATTGAAATTAGAATATCATG AAATAAATCAAAACATACAATGGCAAGTAGTATGCATGCATATTCAAGAGACTCTTCCATTTTTGCAAGCTGTAGAAGGAAATGTCTGAA TGTCTATAAGTTATGGGGTAGATTCTTGAGAAGCATTTCATATAATTTCACTGAAGAACCTTGATAATTTTGACCCACTGTAACTTAGCC ACTGATGAACCTTAAAGCTGAGTATTTTATTAACACCTGATTTGTATTCCATTATATTCAAAATGCATCTTTGGTATTGTGCCTCTGCTC CCATCTCTCTCTTTGCCTCATAGATTTAGCTATGTTGGGAAGCACATGCTTGCTCTAGGAATATCTCCAATAAAGCTGTTAACTATTTGG TGGAAAAA >32532_32532_1_GAS6-GPC5_GAS6_chr13_114566548_ENST00000327773_GPC5_chr13_93518535_ENST00000377067_length(amino acids)=142AA_BP= MKFISSGIPSRGRSRTPPAPPRGCTAPPRTPSPGGPAWPPRRPERRGAAWAAGTAWPRAPATARQARTPRPAAAAAAAARGAGRRARARA KGPWRAGDARSERPGGRGEPRAPRGGGSGHPVLAALKVTSRRRRRRRLRHLK -------------------------------------------------------------- >32532_32532_2_GAS6-GPC5_GAS6_chr13_114566548_ENST00000357389_GPC5_chr13_93518535_ENST00000377067_length(transcript)=1364nt_BP=408nt CCGAGCGCTTGAGGTGCCGCAGCCGCCGCCGCCGCCGCCGCCGCGATGTGACCTTCAGGGCCGCCAGGACGGGATGACCGGAGCCTCCGC CCCGCGGCGCCCGCGGCTCGCCTCGGCCTCCCGGGCGCTCTGACCGCGCGTCCCCGGCCCGCCATGGCCCCTTCGCTCTCGCCCGGGCCC GCCGCCCTGCGCCGCGCGCCGCAGCTGCTGCTGCTGCTGCTGGCCGCGGAGTGCGCGCTTGCCGCGCTGTTGCCGGCGCGCGAGGCCACG CAGTTCCTGCGGCCCAGGCAGCGCCGCGCCTTTCAGGTCTTCGAGGAGGCCAAGCAGGGCCACCTGGAGAGGGAGTGCGTGGAGGAGCTG TGCAGCCGCGAGGAGGCGCGGGAGGTGTTCGAGAACGACCCCGAGACGGGATGCCAGATGATATGAACTTCAGTGATGTAAAGCAAATCC ATCAAACAGACACTGGCAGTACTTTAGACACAACAGGAGCAGGATGTGCAGTGGCGACTGAATCTATGACATTCACTCTGATAAGTGTGG TGATGTTACTTCCCGGGATTTGGTAACTGAACTCTTCTGTCCTGACATACCTTACTGAAGTCTCGATTTCTTCTCTCTCTGCATATGCCT GGAATAAGAGATCCTTTTTCAATGTAACAATTATATTTATGAAAAGATATGTTACACTAACTTCTCAGAAGCCAAGCTGAAATATTCATA AAGTCCCTAAAACTCAACGTTTAAATGACACACTTTAAAAATATGTCTTTTTTCAATCTAACTGAAAACCTTCTTAACTTCTAATATATT AAATCTGAAGATGTGAAGGGCACAGAAGTGACTTTGAATAAGAAGAATTTAGTGTATCTGTAATTTTATTATCAATTCCAAGCCCCTTCC TTTCTAAATTAAAAATGTTTTCATTTGAAAGTGTATTTGCCAGACAATGAAAACAGTATGCAGTATTTCTTAAAGTATTGAAATTAGAAT ATCATGAAATAAATCAAAACATACAATGGCAAGTAGTATGCATGCATATTCAAGAGACTCTTCCATTTTTGCAAGCTGTAGAAGGAAATG TCTGAATGTCTATAAGTTATGGGGTAGATTCTTGAGAAGCATTTCATATAATTTCACTGAAGAACCTTGATAATTTTGACCCACTGTAAC TTAGCCACTGATGAACCTTAAAGCTGAGTATTTTATTAACACCTGATTTGTATTCCATTATATTCAAAATGCATCTTTGGTATTGTGCCT CTGCTCCCATCTCTCTCTTTGCCTCATAGATTTAGCTATGTTGGGAAGCACATGCTTGCTCTAGGAATATCTCCAATAAAGCTGTTAACT ATTTGGTGGAAAAA >32532_32532_2_GAS6-GPC5_GAS6_chr13_114566548_ENST00000357389_GPC5_chr13_93518535_ENST00000377067_length(amino acids)=144AA_BP= MKFISSGIPSRGRSRTPPAPPRGCTAPPRTPSPGGPAWPPRRPERRGAAWAAGTAWPRAPATARQARTPRPAAAAAAAARGAGRRARARA KGPWRAGDARSERPGGRGEPRAPRGGGSGHPVLAALKVTSRRRRRRRLRHLKRS -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for GAS6-GPC5 |
![]() |
![]() |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for GAS6-GPC5 |
![]() (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for GAS6-GPC5 |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | GAS6 | C0040053 | Thrombosis | 4 | CTD_human |
Hgene | GAS6 | C0087086 | Thrombus | 4 | CTD_human |
Hgene | GAS6 | C0010606 | Adenoid Cystic Carcinoma | 1 | CTD_human |
Hgene | GAS6 | C0011881 | Diabetic Nephropathy | 1 | CTD_human |
Hgene | GAS6 | C0017667 | Nodular glomerulosclerosis | 1 | CTD_human |
Hgene | GAS6 | C0018800 | Cardiomegaly | 1 | CTD_human |
Hgene | GAS6 | C0022660 | Kidney Failure, Acute | 1 | CTD_human |
Hgene | GAS6 | C0036095 | Salivary Gland Neoplasms | 1 | CTD_human |
Hgene | GAS6 | C0040038 | Thromboembolism | 1 | CTD_human |
Hgene | GAS6 | C0220636 | Malignant neoplasm of salivary gland | 1 | CTD_human |
Hgene | GAS6 | C1383860 | Cardiac Hypertrophy | 1 | CTD_human |
Hgene | GAS6 | C1565662 | Acute Kidney Insufficiency | 1 | CTD_human |
Hgene | GAS6 | C2609414 | Acute kidney injury | 1 | CTD_human |
Tgene | C0001925 | Albuminuria | 1 | CTD_human | |
Tgene | C0027726 | Nephrotic Syndrome | 1 | CTD_human |