Fusion Gene Studies
in Kim Lab

FusionBase FusionGDB FusionGDB2 FusionPDB FusionNeoAntigen FusionAI FusionNW FGviewer Publication Contact
FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

Fusion Gene Summary

leaf

Fusion Gene ORF analysis

leaf

Fusion Genomic Features

leaf

Fusion Protein Features

leaf

Fusion Gene Sequence

leaf

Fusion Gene PPI analysis

leaf

Related Drugs

leaf

Related Diseases

Fusion gene:CRYL1-MLNR (FusionGDB2 ID:HG51084TG2862)

Fusion Gene Summary for CRYL1-MLNR

check button Fusion gene summary
Fusion gene informationFusion gene name: CRYL1-MLNR
Fusion gene ID: hg51084tg2862
HgeneTgene
Gene symbol

CRYL1

MLNR

Gene ID

51084

2862

Gene namecrystallin lambda 1motilin receptor
SynonymsGDH|HEL30|gul3DH|lambda-CRYGPR38|MTLR1
Cytomap('CRYL1')('MLNR')

13q12.11

13q14.2

Type of geneprotein-codingprotein-coding
Descriptionlambda-crystallin homologL-gulonate 3-dehydrogenasecrystallin, lamda 1epididymis luminal protein 30testicular tissue protein Li 44motilin receptorG protein-coupled receptor 38
Modification date2020031320200313
UniProtAcc..
Ensembl transtripts involved in fusion geneENST00000382812, ENST00000298248, 
ENST00000480748, 
Fusion gene scores* DoF score13 X 11 X 6=8582 X 1 X 2=4
# samples 132
** MAII scorelog2(13/858*10)=-2.72246602447109
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context

PubMed: CRYL1 [Title/Abstract] AND MLNR [Title/Abstract] AND fusion [Title/Abstract]

Most frequent breakpointCRYL1(21099893)-MLNR(49796176), # samples:2
Anticipated loss of major functional domain due to fusion event.CRYL1-MLNR seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF.
CRYL1-MLNR seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check buttonFusion gene breakpoints across CRYL1 (5'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
all structure
check buttonFusion gene breakpoints across MLNR (3'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
all structure

check button Fusion gene information
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
SourceDiseaseSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChimerDB4SARCTCGA-WK-A8XS-01ACRYL1chr13

21099893

-MLNRchr13

49796176

+


Top

Fusion Gene ORF analysis for CRYL1-MLNR

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5UTR-3CDSENST00000382812ENST00000218721CRYL1chr13

21099893

-MLNRchr13

49796176

+
5UTR-3CDSENST00000382812ENST00000398307CRYL1chr13

21099893

-MLNRchr13

49796176

+
Frame-shiftENST00000298248ENST00000398307CRYL1chr13

21099893

-MLNRchr13

49796176

+
In-frameENST00000298248ENST00000218721CRYL1chr13

21099893

-MLNRchr13

49796176

+
intron-3CDSENST00000480748ENST00000218721CRYL1chr13

21099893

-MLNRchr13

49796176

+
intron-3CDSENST00000480748ENST00000398307CRYL1chr13

21099893

-MLNRchr13

49796176

+

check buttonORFfinder result based on the fusion transcript sequence of in-frame fusion genes.
HenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrandSeq length
(transcript)
BP loci
(transcript)
Predicted start
(transcript)
Predicted stop
(transcript)
Seq length
(amino acids)
ENST00000298248CRYL1chr1321099893-ENST00000218721MLNRchr1349796176+44210497441115

check buttonDeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated.
HenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrandNo-coding scoreCoding score
ENST00000298248ENST00000218721CRYL1chr1321099893-MLNRchr1349796176+0.036300240.9636997

Top

Fusion Genomic Features for CRYL1-MLNR


check buttonFusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints.
HgeneHchrHbpHstrandTgeneTchrTbpTstrand1-pp (fusion gene breakpoint)
CRYL1chr1321099892-MLNRchr1349796175+1.11E-050.9999889
CRYL1chr1321099892-MLNRchr1349796175+1.11E-050.9999889

check buttonDistribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page.
genomic feature

check buttonDistribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page.
genomic feature of top 1%

Top

Fusion Protein Features for CRYL1-MLNR


check button Four levels of functional features of fusion genes
Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr13:21099893/chr13:49796176)
- FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels.
- How to search
1. Put your fusion gene symbol.
2. Press the tab key until there will be shown the breakpoint information filled.
4. Go down and press 'Search' tab twice.
4. Go down to have the hyperlink of the search result.
5. Click the hyperlink.
6. See the FGviewer result for your fusion gene.
FGviewer

check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
..
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}.FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page


* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMLNRchr13:21099893chr13:49796176ENST0000021872102321_334300413.0Topological domainExtracellular
TgeneMLNRchr13:21099893chr13:49796176ENST0000021872102359_412300413.0Topological domainCytoplasmic
TgeneMLNRchr13:21099893chr13:49796176ENST0000039830702359_412350387.0Topological domainCytoplasmic
TgeneMLNRchr13:21099893chr13:49796176ENST0000021872102299_320300413.0TransmembraneHelical%3B Name%3D6
TgeneMLNRchr13:21099893chr13:49796176ENST0000021872102335_358300413.0TransmembraneHelical%3B Name%3D7

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCRYL1chr13:21099893chr13:49796176ENST00000298248-1816_1713320.0Nucleotide bindingNAD
HgeneCRYL1chr13:21099893chr13:49796176ENST00000382812-1916_170298.0Nucleotide bindingNAD
TgeneMLNRchr13:21099893chr13:49796176ENST0000021872102135_157300413.0Topological domainCytoplasmic
TgeneMLNRchr13:21099893chr13:49796176ENST0000021872102179_246300413.0Topological domainExtracellular
TgeneMLNRchr13:21099893chr13:49796176ENST00000218721021_35300413.0Topological domainExtracellular
TgeneMLNRchr13:21099893chr13:49796176ENST0000021872102271_298300413.0Topological domainCytoplasmic
TgeneMLNRchr13:21099893chr13:49796176ENST000002187210257_74300413.0Topological domainCytoplasmic
TgeneMLNRchr13:21099893chr13:49796176ENST000002187210295_112300413.0Topological domainExtracellular
TgeneMLNRchr13:21099893chr13:49796176ENST0000039830702135_157350387.0Topological domainCytoplasmic
TgeneMLNRchr13:21099893chr13:49796176ENST0000039830702179_246350387.0Topological domainExtracellular
TgeneMLNRchr13:21099893chr13:49796176ENST00000398307021_35350387.0Topological domainExtracellular
TgeneMLNRchr13:21099893chr13:49796176ENST0000039830702271_298350387.0Topological domainCytoplasmic
TgeneMLNRchr13:21099893chr13:49796176ENST0000039830702321_334350387.0Topological domainExtracellular
TgeneMLNRchr13:21099893chr13:49796176ENST000003983070257_74350387.0Topological domainCytoplasmic
TgeneMLNRchr13:21099893chr13:49796176ENST000003983070295_112350387.0Topological domainExtracellular
TgeneMLNRchr13:21099893chr13:49796176ENST0000021872102113_134300413.0TransmembraneHelical%3B Name%3D3
TgeneMLNRchr13:21099893chr13:49796176ENST0000021872102158_178300413.0TransmembraneHelical%3B Name%3D4
TgeneMLNRchr13:21099893chr13:49796176ENST0000021872102247_270300413.0TransmembraneHelical%3B Name%3D5
TgeneMLNRchr13:21099893chr13:49796176ENST000002187210236_56300413.0TransmembraneHelical%3B Name%3D1
TgeneMLNRchr13:21099893chr13:49796176ENST000002187210275_94300413.0TransmembraneHelical%3B Name%3D2
TgeneMLNRchr13:21099893chr13:49796176ENST0000039830702113_134350387.0TransmembraneHelical%3B Name%3D3
TgeneMLNRchr13:21099893chr13:49796176ENST0000039830702158_178350387.0TransmembraneHelical%3B Name%3D4
TgeneMLNRchr13:21099893chr13:49796176ENST0000039830702247_270350387.0TransmembraneHelical%3B Name%3D5
TgeneMLNRchr13:21099893chr13:49796176ENST0000039830702299_320350387.0TransmembraneHelical%3B Name%3D6
TgeneMLNRchr13:21099893chr13:49796176ENST0000039830702335_358350387.0TransmembraneHelical%3B Name%3D7
TgeneMLNRchr13:21099893chr13:49796176ENST000003983070236_56350387.0TransmembraneHelical%3B Name%3D1
TgeneMLNRchr13:21099893chr13:49796176ENST000003983070275_94350387.0TransmembraneHelical%3B Name%3D2


Top

Fusion Gene Sequence for CRYL1-MLNR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones.
>19610_19610_1_CRYL1-MLNR_CRYL1_chr13_21099893_ENST00000298248_MLNR_chr13_49796176_ENST00000218721_length(transcript)=442nt_BP=104nt
AGAGCTCGCAGCTCCGCCGGCGCCTGGTCCCAGCGCCCGCGGCGCCGCGTCCCCGGCCCAACCATGGCGTCCTCCGCGGCCGGCTGCGTG
GTGATCGTTGGCAGTGGTGGTGGTTCTGGCATTTATAATTTGCTGGTTGCCCTTCCACGTTGGCAGAATCATTTACATAAACACGGAAGA
TTCGCGGATGATGTACTTCTCTCAGTACTTTAACATCGTCGCTCTGCAACTTTTCTATCTGAGCGCATCTATCAACCCAATCCTCTACAA
CCTCATTTCAAAGAAGTACAGAGCGGCGGCCTTTAAACTGCTGCTCGCAAGGAAGTCCAGGCCGAGAGGCTTCCACAGAAGCAGGGACAC
TGCGGGGGAAGTTGCAGGGGACACTGGAGGAGACACGGTGGGCTACACCGAGACAAGCGCTAACGTGAAGACGATGGGATAA

>19610_19610_1_CRYL1-MLNR_CRYL1_chr13_21099893_ENST00000298248_MLNR_chr13_49796176_ENST00000218721_length(amino acids)=115AA_BP=1
MAVVVVLAFIICWLPFHVGRIIYINTEDSRMMYFSQYFNIVALQLFYLSASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAG
EVAGDTGGDTVGYTETSANVKTMGX

--------------------------------------------------------------

Top

Fusion Gene PPI Analysis for CRYL1-MLNR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page.


check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

Related Drugs for CRYL1-MLNR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.8 2021-05-08)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

Related Diseases for CRYL1-MLNR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCRYL1C0033578Prostatic Neoplasms1CTD_human
HgeneCRYL1C0376358Malignant neoplasm of prostate1CTD_human
HgeneCRYL1C0520459Necrotizing Enterocolitis1CTD_human