![]() |
||||||
|
![]() | Fusion Gene Summary |
![]() | Fusion Gene ORF analysis |
![]() | Fusion Genomic Features |
![]() | Fusion Protein Features |
![]() | Fusion Gene Sequence |
![]() | Fusion Gene PPI analysis |
![]() | Related Drugs |
![]() | Related Diseases |
Fusion gene:ENPP1-RIPPLY2 (FusionGDB2 ID:HG5167TG134701) |
Fusion Gene Summary for ENPP1-RIPPLY2 |
![]() |
Fusion gene information | Fusion gene name: ENPP1-RIPPLY2 | Fusion gene ID: hg5167tg134701 | Hgene | Tgene | Gene symbol | ENPP1 | RIPPLY2 | Gene ID | 5167 | 134701 |
Gene name | ectonucleotide pyrophosphatase/phosphodiesterase 1 | ripply transcriptional repressor 2 | |
Synonyms | ARHR2|COLED|M6S1|NPP1|NPPS|PC-1|PCA1|PDNP1 | C6orf159|SCDO6|dJ237I15.1 | |
Cytomap | ('ENPP1')('RIPPLY2') 6q23.2 | 6q14.2 | |
Type of gene | protein-coding | protein-coding | |
Description | ectonucleotide pyrophosphatase/phosphodiesterase family member 1E-NPP 1Ly-41 antigenalkaline phosphodiesterase 1membrane component, chromosome 6, surface marker 1phosphodiesterase I/nucleotide pyrophosphatase 1plasma-cell membrane glycoprotein 1pla | protein ripply2ripply2 homolog | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | . | . | |
Ensembl transtripts involved in fusion gene | ENST00000360971, | ||
Fusion gene scores | * DoF score | 6 X 6 X 4=144 | 2 X 2 X 2=8 |
# samples | 6 | 2 | |
** MAII score | log2(6/144*10)=-1.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(2/8*10)=1.32192809488736 | |
Context | PubMed: ENPP1 [Title/Abstract] AND RIPPLY2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | ENPP1(132129415)-RIPPLY2(84563816), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | ENPP1-RIPPLY2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ENPP1-RIPPLY2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ENPP1-RIPPLY2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ENPP1-RIPPLY2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ENPP1 | GO:0006091 | generation of precursor metabolites and energy | 12746903 |
Hgene | ENPP1 | GO:0006796 | phosphate-containing compound metabolic process | 10513816|11159191 |
Hgene | ENPP1 | GO:0009143 | nucleoside triphosphate catabolic process | 10513816 |
Hgene | ENPP1 | GO:0030308 | negative regulation of cell growth | 17849011 |
Hgene | ENPP1 | GO:0030505 | inorganic diphosphate transport | 10513816 |
Hgene | ENPP1 | GO:0030643 | cellular phosphate ion homeostasis | 11159191 |
Hgene | ENPP1 | GO:0030730 | sequestering of triglyceride | 17849011 |
Hgene | ENPP1 | GO:0031953 | negative regulation of protein autophosphorylation | 11289049 |
Hgene | ENPP1 | GO:0032869 | cellular response to insulin stimulus | 7830796|17849011 |
Hgene | ENPP1 | GO:0045599 | negative regulation of fat cell differentiation | 17849011 |
Hgene | ENPP1 | GO:0045719 | negative regulation of glycogen biosynthetic process | 11289049 |
Hgene | ENPP1 | GO:0046325 | negative regulation of glucose import | 17849011 |
Hgene | ENPP1 | GO:0046627 | negative regulation of insulin receptor signaling pathway | 7830796|17849011 |
Hgene | ENPP1 | GO:0050427 | 3'-phosphoadenosine 5'-phosphosulfate metabolic process | 7830796 |
Hgene | ENPP1 | GO:0090305 | nucleic acid phosphodiester bond hydrolysis | 22285541 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-OL-A6VO-01A | ENPP1 | chr6 | 132129415 | - | RIPPLY2 | chr6 | 84563816 | + |
ChimerDB4 | BRCA | TCGA-OL-A6VO-01A | ENPP1 | chr6 | 132129415 | + | RIPPLY2 | chr6 | 84563816 | + |
Top |
Fusion Gene ORF analysis for ENPP1-RIPPLY2 |
![]() * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
In-frame | ENST00000360971 | ENST00000369687 | ENPP1 | chr6 | 132129415 | + | RIPPLY2 | chr6 | 84563816 | + |
In-frame | ENST00000360971 | ENST00000369689 | ENPP1 | chr6 | 132129415 | + | RIPPLY2 | chr6 | 84563816 | + |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000360971 | ENPP1 | chr6 | 132129415 | + | ENST00000369689 | RIPPLY2 | chr6 | 84563816 | + | 599 | 260 | 20 | 472 | 150 |
ENST00000360971 | ENPP1 | chr6 | 132129415 | + | ENST00000369687 | RIPPLY2 | chr6 | 84563816 | + | 599 | 260 | 20 | 472 | 150 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000360971 | ENST00000369689 | ENPP1 | chr6 | 132129415 | + | RIPPLY2 | chr6 | 84563816 | + | 0.008423076 | 0.9915769 |
ENST00000360971 | ENST00000369687 | ENPP1 | chr6 | 132129415 | + | RIPPLY2 | chr6 | 84563816 | + | 0.008423076 | 0.9915769 |
Top |
Fusion Genomic Features for ENPP1-RIPPLY2 |
![]() |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
ENPP1 | chr6 | 132129415 | + | RIPPLY2 | chr6 | 84563815 | + | 0.005182721 | 0.9948173 |
ENPP1 | chr6 | 132129415 | + | RIPPLY2 | chr6 | 84563815 | + | 0.005182721 | 0.9948173 |
![]() |
![]() |
![]() |
![]() |
Top |
Fusion Protein Features for ENPP1-RIPPLY2 |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr6:132129415/chr6:84563816) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | . |
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. | FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. |
![]() * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ENPP1 | chr6:132129415 | chr6:84563816 | ENST00000360971 | + | 1 | 25 | 45_52 | 80 | 926.0 | Motif | Di-leucine motif |
Hgene | ENPP1 | chr6:132129415 | chr6:84563816 | ENST00000360971 | + | 1 | 25 | 1_76 | 80 | 926.0 | Topological domain | Cytoplasmic |
Tgene | RIPPLY2 | chr6:132129415 | chr6:84563816 | ENST00000369687 | 0 | 3 | 37_40 | 0 | 71.0 | Motif | WRPW motif | |
Tgene | RIPPLY2 | chr6:132129415 | chr6:84563816 | ENST00000369687 | 0 | 3 | 77_112 | 0 | 71.0 | Region | Ripply homology domain | |
Tgene | RIPPLY2 | chr6:132129415 | chr6:84563816 | ENST00000369689 | 1 | 4 | 77_112 | 58 | 129.0 | Region | Ripply homology domain |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ENPP1 | chr6:132129415 | chr6:84563816 | ENST00000360971 | + | 1 | 25 | 104_144 | 80 | 926.0 | Domain | SMB 1 |
Hgene | ENPP1 | chr6:132129415 | chr6:84563816 | ENST00000360971 | + | 1 | 25 | 145_189 | 80 | 926.0 | Domain | SMB 2 |
Hgene | ENPP1 | chr6:132129415 | chr6:84563816 | ENST00000360971 | + | 1 | 25 | 191_591 | 80 | 926.0 | Region | Phosphodiesterase |
Hgene | ENPP1 | chr6:132129415 | chr6:84563816 | ENST00000360971 | + | 1 | 25 | 597_647 | 80 | 926.0 | Region | Linker |
Hgene | ENPP1 | chr6:132129415 | chr6:84563816 | ENST00000360971 | + | 1 | 25 | 654_925 | 80 | 926.0 | Region | Nuclease |
Hgene | ENPP1 | chr6:132129415 | chr6:84563816 | ENST00000360971 | + | 1 | 25 | 98_925 | 80 | 926.0 | Topological domain | Extracellular |
Hgene | ENPP1 | chr6:132129415 | chr6:84563816 | ENST00000360971 | + | 1 | 25 | 77_97 | 80 | 926.0 | Transmembrane | Helical%3B Signal-anchor for type II membrane protein |
Tgene | RIPPLY2 | chr6:132129415 | chr6:84563816 | ENST00000369689 | 1 | 4 | 37_40 | 58 | 129.0 | Motif | WRPW motif |
Top |
Fusion Gene Sequence for ENPP1-RIPPLY2 |
![]() |
>26647_26647_1_ENPP1-RIPPLY2_ENPP1_chr6_132129415_ENST00000360971_RIPPLY2_chr6_84563816_ENST00000369687_length(transcript)=599nt_BP=260nt CCGGAGCGGCCGGGGCCACGATGGAGCGCGACGGCTGCGCGGGGGGCGGGAGCCGCGGCGGCGAGGGCGGGCGCGCTCCCCGGGAGGGCC CGGCGGGGAACGGCCGCGATCGGGGCCGCAGCCACGCTGCCGAGGCGCCCGGGGACCCGCAGGCGGCCGCGTCCTTGCTGGCCCCTATGG ACGTGGGGGAGGAGCCGCTGGAGAAGGCGGCGCGCGCCCGCACTGCCAAGGACCCCAACACCTATAAAGTACTCTCGCTGATGCCCGATG GCCCTGGAATGACCGCAGCCTCAGGAAAGCTTTACCAATTCAGGCACCCAGTCAGACTATTTTGGCCAAAATCAAAATGTTATGATTACT TATATCAAGAAGCAGAAGCTCTTCTGAAAAATTTTCCAATTCAAGCCACAATTTCATTTTATGAAGATTCTGATAGCGAAGATGAAATTG AGGATCTGACCTGTGAAAATTAATCTGATTAGCTACTTTTGATTATATCCAAAGCTTGTGGGGTTTAAATTTAGTGTACAAATGTATCAT >26647_26647_1_ENPP1-RIPPLY2_ENPP1_chr6_132129415_ENST00000360971_RIPPLY2_chr6_84563816_ENST00000369687_length(amino acids)=150AA_BP=75 MERDGCAGGGSRGGEGGRAPREGPAGNGRDRGRSHAAEAPGDPQAAASLLAPMDVGEEPLEKAARARTAKDPNTYKVLSLMPDGPGMTAA -------------------------------------------------------------- >26647_26647_2_ENPP1-RIPPLY2_ENPP1_chr6_132129415_ENST00000360971_RIPPLY2_chr6_84563816_ENST00000369689_length(transcript)=599nt_BP=260nt CCGGAGCGGCCGGGGCCACGATGGAGCGCGACGGCTGCGCGGGGGGCGGGAGCCGCGGCGGCGAGGGCGGGCGCGCTCCCCGGGAGGGCC CGGCGGGGAACGGCCGCGATCGGGGCCGCAGCCACGCTGCCGAGGCGCCCGGGGACCCGCAGGCGGCCGCGTCCTTGCTGGCCCCTATGG ACGTGGGGGAGGAGCCGCTGGAGAAGGCGGCGCGCGCCCGCACTGCCAAGGACCCCAACACCTATAAAGTACTCTCGCTGATGCCCGATG GCCCTGGAATGACCGCAGCCTCAGGAAAGCTTTACCAATTCAGGCACCCAGTCAGACTATTTTGGCCAAAATCAAAATGTTATGATTACT TATATCAAGAAGCAGAAGCTCTTCTGAAAAATTTTCCAATTCAAGCCACAATTTCATTTTATGAAGATTCTGATAGCGAAGATGAAATTG AGGATCTGACCTGTGAAAATTAATCTGATTAGCTACTTTTGATTATATCCAAAGCTTGTGGGGTTTAAATTTAGTGTACAAATGTATCAT >26647_26647_2_ENPP1-RIPPLY2_ENPP1_chr6_132129415_ENST00000360971_RIPPLY2_chr6_84563816_ENST00000369689_length(amino acids)=150AA_BP=75 MERDGCAGGGSRGGEGGRAPREGPAGNGRDRGRSHAAEAPGDPQAAASLLAPMDVGEEPLEKAARARTAKDPNTYKVLSLMPDGPGMTAA -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ENPP1-RIPPLY2 |
![]() |
![]() |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ENPP1-RIPPLY2 |
![]() (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for ENPP1-RIPPLY2 |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | ENPP1 | C4551985 | ARTERIAL CALCIFICATION, GENERALIZED, OF INFANCY, 1 | 7 | GENOMICS_ENGLAND;UNIPROT |
Hgene | ENPP1 | C2750078 | Hypophosphatemic Rickets, Autosomal Recessive, 2 | 4 | CTD_human;GENOMICS_ENGLAND;UNIPROT |
Hgene | ENPP1 | C3809781 | Cole disease | 4 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
Hgene | ENPP1 | C0014175 | Endometriosis | 1 | CTD_human |
Hgene | ENPP1 | C0033847 | Pseudoxanthoma Elasticum | 1 | ORPHANET |
Hgene | ENPP1 | C0269102 | Endometrioma | 1 | CTD_human |
Hgene | ENPP1 | C1865343 | OSSIFICATION OF THE POSTERIOR LONGITUDINAL LIGAMENT OF SPINE | 1 | GENOMICS_ENGLAND;UNIPROT |
Tgene | C0265343 | Jarcho-Levin syndrome | 1 | ORPHANET | |
Tgene | C4225279 | SPONDYLOCOSTAL DYSOSTOSIS 6, AUTOSOMAL RECESSIVE | 1 | GENOMICS_ENGLAND |