![]() |
||||||
|
![]() | Fusion Gene Summary |
![]() | Fusion Gene ORF analysis |
![]() | Fusion Genomic Features |
![]() | Fusion Protein Features |
![]() | Fusion Gene Sequence |
![]() | Fusion Gene PPI analysis |
![]() | Related Drugs |
![]() | Related Diseases |
Fusion gene:KCMF1-ASXL1 (FusionGDB2 ID:HG56888TG171023) |
Fusion Gene Summary for KCMF1-ASXL1 |
![]() |
Fusion gene information | Fusion gene name: KCMF1-ASXL1 | Fusion gene ID: hg56888tg171023 | Hgene | Tgene | Gene symbol | KCMF1 | ASXL1 | Gene ID | 56888 | 171023 |
Gene name | potassium channel modulatory factor 1 | ASXL transcriptional regulator 1 | |
Synonyms | DEBT91|FIGC|PCMF|ZZZ1 | BOPS|MDS | |
Cytomap | ('KCMF1')('ASXL1') 2p11.2 | 20q11.21 | |
Type of gene | protein-coding | protein-coding | |
Description | E3 ubiquitin-protein ligase KCMF1FGF-induced in gastric cancerFGF-induced ubiquitin-protein ligase in gastric cancersRING-type E3 ubiquitin transferase KCMF1ZZ-type zinc finger-containing protein 1differentially expressed in branching tubulogenesis 9 | polycomb group protein ASXL1additional sex combs like 1, transcriptional regulatoradditional sex combs like transcriptional regulator 1putative Polycomb group protein ASXL1 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | . | . | |
Ensembl transtripts involved in fusion gene | ENST00000409785, | ||
Fusion gene scores | * DoF score | 14 X 12 X 7=1176 | 10 X 7 X 6=420 |
# samples | 18 | 10 | |
** MAII score | log2(18/1176*10)=-2.70781924850669 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(10/420*10)=-2.0703893278914 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: KCMF1 [Title/Abstract] AND ASXL1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | KCMF1(85198590)-ASXL1(30954187), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | KCMF1-ASXL1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. KCMF1-ASXL1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. KCMF1-ASXL1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. KCMF1-ASXL1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. KCMF1-ASXL1 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. KCMF1-ASXL1 seems lost the major protein functional domain in Hgene partner, which is a transcription factor due to the frame-shifted ORF. KCMF1-ASXL1 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. KCMF1-ASXL1 seems lost the major protein functional domain in Tgene partner, which is a epigenetic factor due to the frame-shifted ORF. KCMF1-ASXL1 seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | ASXL1 | GO:0035522 | monoubiquitinated histone H2A deubiquitination | 20436459 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-BR-8295-01A | KCMF1 | chr2 | 85198590 | + | ASXL1 | chr20 | 30954187 | + |
Top |
Fusion Gene ORF analysis for KCMF1-ASXL1 |
![]() * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
Frame-shift | ENST00000409785 | ENST00000306058 | KCMF1 | chr2 | 85198590 | + | ASXL1 | chr20 | 30954187 | + |
Frame-shift | ENST00000409785 | ENST00000375687 | KCMF1 | chr2 | 85198590 | + | ASXL1 | chr20 | 30954187 | + |
Frame-shift | ENST00000409785 | ENST00000375689 | KCMF1 | chr2 | 85198590 | + | ASXL1 | chr20 | 30954187 | + |
Frame-shift | ENST00000409785 | ENST00000542461 | KCMF1 | chr2 | 85198590 | + | ASXL1 | chr20 | 30954187 | + |
In-frame | ENST00000409785 | ENST00000470145 | KCMF1 | chr2 | 85198590 | + | ASXL1 | chr20 | 30954187 | + |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000409785 | KCMF1 | chr2 | 85198590 | + | ENST00000470145 | ASXL1 | chr20 | 30954187 | + | 1448 | 375 | 369 | 716 | 115 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000409785 | ENST00000470145 | KCMF1 | chr2 | 85198590 | + | ASXL1 | chr20 | 30954187 | + | 0.017689515 | 0.9823104 |
Top |
Fusion Genomic Features for KCMF1-ASXL1 |
![]() |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
KCMF1 | chr2 | 85198590 | + | ASXL1 | chr20 | 30954186 | + | 7.59E-07 | 0.9999993 |
KCMF1 | chr2 | 85198590 | + | ASXL1 | chr20 | 30954186 | + | 7.59E-07 | 0.9999993 |
![]() |
![]() |
![]() |
![]() |
Top |
Fusion Protein Features for KCMF1-ASXL1 |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:85198590/chr20:30954187) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | . |
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. | FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. |
![]() * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | ASXL1 | chr2:85198590 | chr20:30954187 | ENST00000375687 | 0 | 13 | 1457_1460 | 19 | 1542.0 | Compositional bias | Note=Poly-Ser | |
Tgene | ASXL1 | chr2:85198590 | chr20:30954187 | ENST00000375687 | 0 | 13 | 199_209 | 19 | 1542.0 | Compositional bias | Note=Poly-Ser | |
Tgene | ASXL1 | chr2:85198590 | chr20:30954187 | ENST00000375687 | 0 | 13 | 641_684 | 19 | 1542.0 | Compositional bias | Note=Gly-rich | |
Tgene | ASXL1 | chr2:85198590 | chr20:30954187 | ENST00000375687 | 0 | 13 | 255_364 | 19 | 1542.0 | Domain | DEUBAD | |
Tgene | ASXL1 | chr2:85198590 | chr20:30954187 | ENST00000375687 | 0 | 13 | 160_164 | 19 | 1542.0 | Motif | Nuclear localization signal 1 | |
Tgene | ASXL1 | chr2:85198590 | chr20:30954187 | ENST00000375687 | 0 | 13 | 284_288 | 19 | 1542.0 | Motif | Note=LXXLL motif | |
Tgene | ASXL1 | chr2:85198590 | chr20:30954187 | ENST00000375687 | 0 | 13 | 409_413 | 19 | 1542.0 | Motif | Nuclear localization signal 2 | |
Tgene | ASXL1 | chr2:85198590 | chr20:30954187 | ENST00000375687 | 0 | 13 | 1503_1540 | 19 | 1542.0 | Zinc finger | Note=PHD-type%3B atypical |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | KCMF1 | chr2:85198590 | chr20:30954187 | ENST00000409785 | + | 1 | 7 | 225_257 | 5 | 382.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | KCMF1 | chr2:85198590 | chr20:30954187 | ENST00000409785 | + | 1 | 7 | 333_336 | 5 | 382.0 | Compositional bias | Note=Poly-Ser |
Hgene | KCMF1 | chr2:85198590 | chr20:30954187 | ENST00000409785 | + | 1 | 7 | 376_380 | 5 | 382.0 | Compositional bias | Note=Poly-Pro |
Hgene | KCMF1 | chr2:85198590 | chr20:30954187 | ENST00000409785 | + | 1 | 7 | 3_50 | 5 | 382.0 | Zinc finger | ZZ-type |
Hgene | KCMF1 | chr2:85198590 | chr20:30954187 | ENST00000409785 | + | 1 | 7 | 78_101 | 5 | 382.0 | Zinc finger | C2H2-type |
Tgene | ASXL1 | chr2:85198590 | chr20:30954187 | ENST00000375687 | 0 | 13 | 2_9 | 19 | 1542.0 | Compositional bias | Note=Poly-Lys | |
Tgene | ASXL1 | chr2:85198590 | chr20:30954187 | ENST00000375687 | 0 | 13 | 11_86 | 19 | 1542.0 | Domain | HTH HARE-type |
Top |
Fusion Gene Sequence for KCMF1-ASXL1 |
![]() |
>41317_41317_1_KCMF1-ASXL1_KCMF1_chr2_85198590_ENST00000409785_ASXL1_chr20_30954187_ENST00000470145_length(transcript)=1448nt_BP=375nt GCGGGGGGTGGGCCGGGGGAGGGGAGGAGCGGGATTTGCGGAGCGCCGCGCCGCTGCCGGGAGCCGGCAGGCCCGAGAGTGACCGGAGTC ACGGCGGGCGCCGGCGGAGCTGCGGCGTCGGACCCGCCTCCTGGAGGAGCTCAGCCCCGACCAGGCCCGGCCCCATTCCCGCCCCGCGCC GCCTCCCCGCCGCCGCCGCCGCCGCCGCCGCGGGAGCGCTCCCCTGCCCACCCCGCCCCCGCGGCCGAGCCCGGGAGTCGAGTGGGAGTC GGCCGGCCGGCGCGGGCAGCGCCGGGACCCCGCGGGGGACACTGCAGCCGGAGCCCGGGAGGGGCCGCGCCGCCACCGTCTGAACTAGGA TGTCCCGACATGAAGGTATTAGAAAACTACTCGGATGCTCCAATGACACCAAAACAGATTCTGCAGGTCATAGAGGCAGAAGGACTAAAG GAAATGAGAAGTGGGACTTCCCCTCTCGCATGCCTCAATGCTATGCTACATTCCAATTCAAGAGGAGGAGAGGGGTTGTTTTATAAACTG CCTGGCCGAATCAGCCTTTTCACGCTCAAGAAGGATGCCCTGCAGTGGTCTCGCCATCCAGCTACAGTGGAGGGAGAGGAGCCAGAGGAC ACGGCTGATGTGGAGAGCTGTGGGTCTAATGAAGCCAGCACTGTGAGTGGTGAAAACGATGGTAAGGACCCTTTAATGGATGGGTGAGGG AGCCACAGCAGGCACTAGGGACTAACCTTTATTTTCCTCTCTTCCAGTATCTCTTGATGAAACATCTTCGAACGCATCCTGTTCTACAGA ATCTCAGAGTCGACCTCTTTCCAATCCCAGGGACAGCTACAGAGCTTCCTCACAGGCGAACAAACAAAAGAAAAAGACTGGGGTGATGCT GCCTCGAGTTGTCCTGACTCCTCTGAAGGTAAACGGGGCCCACGTGGAATCTGCATCAGGTATGTGTAAACTCATGGTTGTGATGCTTTT TCCTCAGGTCCTGGGGACCTGGCCTCCCTCTGTCAGCAGTTTCTGACCTAATAGTGCGATACTAGGAGAGCTGTCGGGCCACAGGCAAGA GCCCTGCCAATGGATGAGGCCTGCCATAGGTTCTAGTGCTGGGCTCTGCTGTGTGCCTTCCTCTTTGTCTCCCAGGGCAGTCGTGAGGAT CCAACGGAGGATTTGATTATGCCAGTGCTTTGTAAAAGGTGTAGTGCTATACAAATAAAGATGGCAGTTTGGCACCTGTAAGGTGATATT TTAAAGCCAGACCATGAAGTGGTGGTTTCTCTCAGCCTAAGGCTGGGAGATGGAAGCATCCCAGTATTGCTGGCAGCATCTCAGGGAGAG CTGGGAGAAATGAGCTTGTCTGAGAGCCATGGGCGCGGCTTGGTGATACTTTTGACCAGTGGAATGCTGTGCCTTCAGGGTTCTCGGGCT >41317_41317_1_KCMF1-ASXL1_KCMF1_chr2_85198590_ENST00000409785_ASXL1_chr20_30954187_ENST00000470145_length(amino acids)=115AA_BP=2 MKVLENYSDAPMTPKQILQVIEAEGLKEMRSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKKDALQWSRHPATVEGEEPEDTAD -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for KCMF1-ASXL1 |
![]() |
![]() |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
Tgene | ASXL1 | chr2:85198590 | chr20:30954187 | ENST00000375687 | 0 | 13 | 300_658 | 19.0 | 1542.0 | NCOA1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for KCMF1-ASXL1 |
![]() (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for KCMF1-ASXL1 |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Tgene | C0796232 | Bohring syndrome | 3 | CTD_human;GENOMICS_ENGLAND;ORPHANET | |
Tgene | C0349639 | Juvenile Myelomonocytic Leukemia | 2 | CTD_human;GENOMICS_ENGLAND | |
Tgene | C3463824 | MYELODYSPLASTIC SYNDROME | 2 | CGI;CTD_human;GENOMICS_ENGLAND | |
Tgene | C0023487 | Acute Promyelocytic Leukemia | 1 | CTD_human | |
Tgene | C0027643 | Neoplasm Recurrence, Local | 1 | CTD_human | |
Tgene | C0027708 | Nephroblastoma | 1 | CTD_human | |
Tgene | C1301365 | Systemic mastocytosis with associated clonal, hematologic non-mast-cell lineage disease | 1 | ORPHANET | |
Tgene | C2713368 | Hematopoetic Myelodysplasia | 1 | CTD_human | |
Tgene | C2930471 | Bilateral Wilms Tumor | 1 | CTD_human |