![]() |
||||||
|
![]() | Fusion Gene Summary |
![]() | Fusion Gene ORF analysis |
![]() | Fusion Genomic Features |
![]() | Fusion Protein Features |
![]() | Fusion Gene Sequence |
![]() | Fusion Gene PPI analysis |
![]() | Related Drugs |
![]() | Related Diseases |
Fusion gene:PTEN-EMX2 (FusionGDB2 ID:HG5728TG2018) |
Fusion Gene Summary for PTEN-EMX2 |
![]() |
Fusion gene information | Fusion gene name: PTEN-EMX2 | Fusion gene ID: hg5728tg2018 | Hgene | Tgene | Gene symbol | PTEN | EMX2 | Gene ID | 5728 | 2018 |
Gene name | phosphatase and tensin homolog | empty spiracles homeobox 2 | |
Synonyms | 10q23del|BZS|CWS1|DEC|GLM2|MHAM|MMAC1|PTEN1|PTENbeta|TEP1 | - | |
Cytomap | ('PTEN')('EMX2') 10q23.31 | 10q26.11 | |
Type of gene | protein-coding | protein-coding | |
Description | phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTENMMAC1 phosphatase and tensin homolog deleted on chromosome 10PTENepsilonmitochondrial PTENalphamitochondrial phosphatase and tensin protein alphamutat | homeobox protein EMX2empty spiracles homolog 2empty spiracles-like protein 2 | |
Modification date | 20200329 | 20200313 | |
UniProtAcc | . | . | |
Ensembl transtripts involved in fusion gene | ENST00000371953, ENST00000472832, | ||
Fusion gene scores | * DoF score | 32 X 22 X 15=10560 | 2 X 4 X 2=16 |
# samples | 42 | 2 | |
** MAII score | log2(42/10560*10)=-4.65207669657969 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(2/16*10)=0.321928094887362 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
Context | PubMed: PTEN [Title/Abstract] AND EMX2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | PTEN(89653866)-EMX2(119305142), # samples:1 PTEN(89653866)-EMX2(119305143), # samples:1 PTEN(89653866)-EMX2(119307576), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | PTEN-EMX2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. PTEN-EMX2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. PTEN-EMX2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. PTEN-EMX2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. PTEN-EMX2 seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. PTEN-EMX2 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. PTEN-EMX2 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. PTEN-EMX2 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. PTEN-EMX2 seems lost the major protein functional domain in Tgene partner, which is a transcription factor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | PTEN | GO:0001933 | negative regulation of protein phosphorylation | 20123964 |
Hgene | PTEN | GO:0006470 | protein dephosphorylation | 9256433 |
Hgene | PTEN | GO:0008285 | negative regulation of cell proliferation | 19057511 |
Hgene | PTEN | GO:0045736 | negative regulation of cyclin-dependent protein serine/threonine kinase activity | 21241890 |
Hgene | PTEN | GO:0046855 | inositol phosphate dephosphorylation | 9593664 |
Hgene | PTEN | GO:0046856 | phosphatidylinositol dephosphorylation | 9593664|9811831 |
Hgene | PTEN | GO:0050821 | protein stabilization | 20123964 |
Hgene | PTEN | GO:0060070 | canonical Wnt signaling pathway | 20123964 |
Hgene | PTEN | GO:1902807 | negative regulation of cell cycle G1/S phase transition | 10918569 |
Hgene | PTEN | GO:1904668 | positive regulation of ubiquitin protein ligase activity | 21241890 |
Hgene | PTEN | GO:2000060 | positive regulation of ubiquitin-dependent protein catabolic process | 21241890 |
Hgene | PTEN | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle | 21241890 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LUSC | TCGA-94-7557 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305142 | + |
ChimerDB4 | LUSC | TCGA-94-7557 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305143 | + |
ChimerDB4 | LUSC | TCGA-94-7557 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119307576 | + |
Top |
Fusion Gene ORF analysis for PTEN-EMX2 |
![]() * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-3UTR | ENST00000371953 | ENST00000546446 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305142 | + |
5CDS-3UTR | ENST00000371953 | ENST00000546446 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305143 | + |
5CDS-3UTR | ENST00000371953 | ENST00000546446 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119307576 | + |
5CDS-intron | ENST00000371953 | ENST00000442245 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305142 | + |
5CDS-intron | ENST00000371953 | ENST00000442245 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305143 | + |
Frame-shift | ENST00000371953 | ENST00000553456 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305142 | + |
Frame-shift | ENST00000371953 | ENST00000553456 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305143 | + |
Frame-shift | ENST00000371953 | ENST00000553456 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119307576 | + |
In-frame | ENST00000371953 | ENST00000442245 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119307576 | + |
intron-3CDS | ENST00000472832 | ENST00000442245 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119307576 | + |
intron-3CDS | ENST00000472832 | ENST00000553456 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305142 | + |
intron-3CDS | ENST00000472832 | ENST00000553456 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305143 | + |
intron-3CDS | ENST00000472832 | ENST00000553456 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119307576 | + |
intron-3UTR | ENST00000472832 | ENST00000546446 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305142 | + |
intron-3UTR | ENST00000472832 | ENST00000546446 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305143 | + |
intron-3UTR | ENST00000472832 | ENST00000546446 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119307576 | + |
intron-intron | ENST00000472832 | ENST00000442245 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305142 | + |
intron-intron | ENST00000472832 | ENST00000442245 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305143 | + |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000371953 | PTEN | chr10 | 89653866 | + | ENST00000442245 | EMX2 | chr10 | 119307576 | + | 2358 | 1521 | 556 | 1524 | 322 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000371953 | ENST00000442245 | PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119307576 | + | 0.6363575 | 0.36364257 |
Top |
Fusion Genomic Features for PTEN-EMX2 |
![]() |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119307575 | + | 0.000699542 | 0.9993005 |
PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305142 | + | 2.93E-05 | 0.9999707 |
PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119307575 | + | 0.000699542 | 0.9993005 |
PTEN | chr10 | 89653866 | + | EMX2 | chr10 | 119305142 | + | 2.93E-05 | 0.9999707 |
![]() |
![]() |
![]() |
![]() |
Top |
Fusion Protein Features for PTEN-EMX2 |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr10:89653866/chr10:119305142) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | . |
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. | FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. |
![]() * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | EMX2 | chr10:89653866 | chr10:119307576 | ENST00000442245 | 0 | 2 | 154_213 | 135 | 170.0 | DNA binding | Homeobox |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | PTEN | chr10:89653866 | chr10:119307576 | ENST00000371953 | + | 2 | 9 | 14_185 | 54 | 404.0 | Domain | Phosphatase tensin-type |
Hgene | PTEN | chr10:89653866 | chr10:119307576 | ENST00000371953 | + | 2 | 9 | 190_350 | 54 | 404.0 | Domain | C2 tensin-type |
Hgene | PTEN | chr10:89653866 | chr10:119307576 | ENST00000371953 | + | 2 | 9 | 401_403 | 54 | 404.0 | Region | Note=PDZ domain-binding |
Tgene | EMX2 | chr10:89653866 | chr10:119307576 | ENST00000442245 | 0 | 2 | 54_59 | 135 | 170.0 | Compositional bias | Note=Poly-Ala | |
Tgene | EMX2 | chr10:89653866 | chr10:119307576 | ENST00000553456 | 1 | 3 | 54_59 | 197 | 253.0 | Compositional bias | Note=Poly-Ala | |
Tgene | EMX2 | chr10:89653866 | chr10:119307576 | ENST00000553456 | 1 | 3 | 154_213 | 197 | 253.0 | DNA binding | Homeobox |
Top |
Fusion Gene Sequence for PTEN-EMX2 |
![]() |
>69912_69912_1_PTEN-EMX2_PTEN_chr10_89653866_ENST00000371953_EMX2_chr10_119307576_ENST00000442245_length(transcript)=2358nt_BP=1521nt GGTAACCTCAGACTCGAGTCAGTGACACTGCTCAACGCACCCATCTCAGCTTTCATCATCAGTCCTCCACCCCCGCCCCACAACAGCCTA CCCTGCCTCCGGCTGGGTTTCTGGGCAGAGGCCGAGGCTTAGCTCGTTATCCTCGCCTCGCGTTGCTGCAAAAGCCGCAGCAAGTGCAGC TGCAGGCTGGCGGCTGGGAACCGGCCCGAGCAAGCCCCAGGCAGCTACACTGGGCATGCTCAGTAGAGCCTGCGGCTTGGGGACTCTGCG CTCGCACCCAGAGCTACCGCTCTGCCCCCTCCTACCGCCCCCTGCCCTGCCCTGCCCTCCCCTCGCCCGGCGCGGTCCCGTCCGCCTCTC GCTCGCCTCCCGCCTCCCCTCGGTCTTCCGAGGCGCCCGGGCTCCCGGCGCGGCGGCGGAGGGGGCGGGCAGGCCGGCGGGCGGTGATGT GGCGGGACTCTTTATGCGCTGCGGCAGGATACGCGCTCGGCGCTGGGACGCGACTGCGCTCAGTTCTCTCCTCTCGGAAGCTGCAGCCAT GATGGAAGTTTGAGAGTTGAGCCGCTGTGAGGCGAGGCCGGGCTCAGGCGAGGGAGATGAGAGACGGCGGCGGCCGCGGCCCGGAGCCCC TCTCAGCGCCTGTGAGCAGCCGCGGGGGCAGCGCCCTCGGGGAGCCGGCCGGCCTGCGGCGGCGGCAGCGGCGGCGTTTCTCGCCTCCTC TTCGTCTTTTCTAACCGTGCAGCCTCTTCCTCGGCTTCTCCTGAAAGGGAAGGTGGAAGCCGTGGGCTCGGGCGGGAGCCGGCTGAGGCG CGGCGGCGGCGGCGGCACCTCCCGCTCCTGGAGCGGGGGGGAGAAGCGGCGGCGGCGGCGGCCGCGGCGGCTGCAGCTCCAGGGAGGGGG TCTGAGTCGCCTGTCACCATTTCCAGGGCTGGGAACGCCGGAGAGTTGGTCTCTCCCCTTCTACTGCCTCCAACACGGCGGCGGCGGCGG CTGGCACATCCAGGGACCCGGGCCGGTTTTAAACCTCCCGTGCGCCGCCGCCGCACCCCCCGTGGCCCGGGCTCCGGAGGCCGCCGGCGG AGGCAGCCGTTCGGAGGATTATTCGTCTTCTCCCCATTCCGCTGCCGCCGCTGCCAGGCCTCTGGCTGCTGAGGAGAAGCAGGCCCAGTC GCTGCAACCATCCAGCAGCCGCCGCAGCAGCCATTACCCGGCTGCGGTCCAGAGCCAAGCGGCGGCAGAGCGAGGGGCATCAGCTACCGC CAAGTCCAGAGCCATTTCCATCCTGCAGAAGAAGCCCCGCCACCAGCAGCTTCTGCCATCTCTCTCCTCCTTTTTCTTCAGCCACAGGCT CCCAGACATGACAGCCATCATCAAAGAGATCGTTAGCAGAAACAAAAGGAGATATCAAGAGGATGGATTCGACTTAGACTTGACCTATAT TTATCCAAACATTATTGCTATGGGATTTCCTGCAGAAAGACTTGAAGGCGTATACAGGAACAATATTGATGATGTAGTAAGGTAAAAGTA TGGTTTCAGAACCGAAGAACAAAGTTCAAAAGGCAGAAGCTGGAGGAAGAAGGCTCAGATTCGCAACAAAAGAAAAAAGGGACGCACCAT ATTAACCGGTGGAGAATCGCCACCAAGCAGGCGAGTCCGGAGGAAATAGACGTGACCTCAGATGATTAAAAACATAAACCTAACCCCACA GAAACGGACAACATGGAGCAAAAGAGACAGGGAGAGGTGGAGAAGGAAAAAACCCTACAAAACAAAAACAAACCGCATACACGTTCACCG AGAAAGGGAGAGGGAATCGGAGGGAGCAGCGGAATGCGGCGAAGACTCTGGACAGCGAGGGCACAGGGTCCCAAACCGAGGCCGCGCCAA GATGGCAGAGGATGGAGGCTCCTTCATCAACAAGCGACCCTCGTCTAAAGAGGCAGCTGAGTGAGAGACACAGAGAGAAGGAGAAAGAGG GAGGGAGAGAGAGAAAGAGAGAGAAAGAGAGAGAGAGAGAGAGAGAGAGAAAGCTGAACGTGCACTCTGACAAGGGGAGCTGTCAATCAA ACACCAAACCGGGGAGACAAGATGATTGGCAGGTATTCCGTTTATCACAGTCCACTTAAAAAATGATGATGATGATAAAAACCACGACCC AACCAGGCACAGGACTTTTTTGTTTTTTGCACTTCGCTGTGTTTCCCCCCCATCTTTAAAAATAATTAGTAATAAAAAACAAAAATTCCA TATCTAGCCCCATCCCACACCTGTTTCAAATCCTTGAAATGCATGTAGCAGTTGTTGGGCGAATGGTGTTTAAAGACCGAAAATGAATTG TAATTTTCTTTTCCTTTT >69912_69912_1_PTEN-EMX2_PTEN_chr10_89653866_ENST00000371953_EMX2_chr10_119307576_ENST00000442245_length(amino acids)=322AA_BP= MSRCEARPGSGEGDERRRRPRPGAPLSACEQPRGQRPRGAGRPAAAAAAAFLASSSSFLTVQPLPRLLLKGKVEAVGSGGSRLRRGGGGG TSRSWSGGEKRRRRRPRRLQLQGGGLSRLSPFPGLGTPESWSLPFYCLQHGGGGGWHIQGPGPVLNLPCAAAAPPVARAPEAAGGGSRSE DYSSSPHSAAAAARPLAAEEKQAQSLQPSSSRRSSHYPAAVQSQAAAERGASATAKSRAISILQKKPRHQQLLPSLSSFFFSHRLPDMTA IIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVR -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for PTEN-EMX2 |
![]() |
![]() |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for PTEN-EMX2 |
![]() (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for PTEN-EMX2 |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | PTEN | C0018553 | Hamartoma Syndrome, Multiple | 36 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
Hgene | PTEN | C1959582 | PTEN Hamartoma Tumor Syndrome | 23 | CLINGEN;CTD_human;GENOMICS_ENGLAND |
Hgene | PTEN | C0376358 | Malignant neoplasm of prostate | 18 | CTD_human;GENOMICS_ENGLAND;UNIPROT |
Hgene | PTEN | C0265326 | Bannayan-Riley-Ruvalcaba Syndrome | 16 | CTD_human;GENOMICS_ENGLAND |
Hgene | PTEN | C0033578 | Prostatic Neoplasms | 15 | CTD_human |
Hgene | PTEN | C0391826 | Lhermitte-Duclos disease | 15 | CTD_human;GENOMICS_ENGLAND;ORPHANET |
Hgene | PTEN | C0085261 | Proteus Syndrome | 6 | CTD_human;GENOMICS_ENGLAND;ORPHANET |
Hgene | PTEN | C0376634 | Craniofacial Abnormalities | 6 | CTD_human |
Hgene | PTEN | C1854416 | MACROCEPHALY/AUTISM SYNDROME | 6 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
Hgene | PTEN | C0020796 | Profound Mental Retardation | 5 | CTD_human |
Hgene | PTEN | C0025202 | melanoma | 5 | CGI;CTD_human;GENOMICS_ENGLAND;UNIPROT |
Hgene | PTEN | C0025363 | Mental Retardation, Psychosocial | 5 | CTD_human |
Hgene | PTEN | C0476089 | Endometrial Carcinoma | 5 | CGI;CTD_human;GENOMICS_ENGLAND;UNIPROT |
Hgene | PTEN | C0917816 | Mental deficiency | 5 | CTD_human |
Hgene | PTEN | C3714756 | Intellectual Disability | 5 | CTD_human |
Hgene | PTEN | C0004352 | Autistic Disorder | 4 | CTD_human |
Hgene | PTEN | C0006142 | Malignant neoplasm of breast | 4 | CGI;CTD_human;UNIPROT |
Hgene | PTEN | C0014170 | Endometrial Neoplasms | 4 | CTD_human |
Hgene | PTEN | C0678222 | Breast Carcinoma | 4 | CGI;CTD_human |
Hgene | PTEN | C1257931 | Mammary Neoplasms, Human | 4 | CTD_human |
Hgene | PTEN | C1458155 | Mammary Neoplasms | 4 | CTD_human |
Hgene | PTEN | C1866398 | Proteus-Like Syndrome (disorder) | 4 | CTD_human;GENOMICS_ENGLAND;ORPHANET |
Hgene | PTEN | C4704874 | Mammary Carcinoma, Human | 4 | CTD_human |
Hgene | PTEN | C0008073 | Developmental Disabilities | 3 | CTD_human |
Hgene | PTEN | C0085996 | Child Development Deviations | 3 | CTD_human |
Hgene | PTEN | C0085997 | Child Development Disorders, Specific | 3 | CTD_human |
Hgene | PTEN | C0345893 | Juvenile polyposis syndrome | 3 | ORPHANET |
Hgene | PTEN | C1168401 | Squamous cell carcinoma of the head and neck | 3 | CGI;CTD_human;GENOMICS_ENGLAND;UNIPROT |
Hgene | PTEN | C1848599 | VACTERL Association With Hydrocephalus | 3 | CTD_human;GENOMICS_ENGLAND |
Hgene | PTEN | C0024121 | Lung Neoplasms | 2 | CGI;CTD_human |
Hgene | PTEN | C0242379 | Malignant neoplasm of lung | 2 | CGI;CTD_human |
Hgene | PTEN | C0282612 | Prostatic Intraepithelial Neoplasias | 2 | CTD_human |
Hgene | PTEN | C2751642 | GLIOMA SUSCEPTIBILITY 2 | 2 | GENOMICS_ENGLAND;UNIPROT |
Hgene | PTEN | C0000772 | Multiple congenital anomalies | 1 | CTD_human |
Hgene | PTEN | C0001418 | Adenocarcinoma | 1 | CTD_human |
Hgene | PTEN | C0003081 | Anisometropia | 1 | CTD_human |
Hgene | PTEN | C0004096 | Asthma | 1 | CTD_human |
Hgene | PTEN | C0004565 | Melanoma, B16 | 1 | CTD_human |
Hgene | PTEN | C0007097 | Carcinoma | 1 | CTD_human |
Hgene | PTEN | C0007134 | Renal Cell Carcinoma | 1 | CTD_human |
Hgene | PTEN | C0007621 | Neoplastic Cell Transformation | 1 | CTD_human |
Hgene | PTEN | C0009075 | Melanoma, Cloudman S91 | 1 | CTD_human |
Hgene | PTEN | C0010606 | Adenoid Cystic Carcinoma | 1 | CTD_human |
Hgene | PTEN | C0011757 | Developmental Coordination Disorder | 1 | CTD_human |
Hgene | PTEN | C0014173 | Endometrial Hyperplasia | 1 | CTD_human |
Hgene | PTEN | C0015695 | Fatty Liver | 1 | CTD_human |
Hgene | PTEN | C0017638 | Glioma | 1 | CGI;CTD_human;UNIPROT |
Hgene | PTEN | C0018598 | Melanoma, Harding-Passey | 1 | CTD_human |
Hgene | PTEN | C0018916 | Hemangioma | 1 | CTD_human |
Hgene | PTEN | C0020538 | Hypertensive disease | 1 | CTD_human |
Hgene | PTEN | C0020564 | Hypertrophy | 1 | CTD_human |
Hgene | PTEN | C0021655 | Insulin Resistance | 1 | CTD_human |
Hgene | PTEN | C0023012 | Language Delay | 1 | CTD_human |
Hgene | PTEN | C0023014 | Language Development Disorders | 1 | CTD_human |
Hgene | PTEN | C0023418 | leukemia | 1 | CTD_human |
Hgene | PTEN | C0023798 | Lipoma | 1 | CTD_human |
Hgene | PTEN | C0023801 | Lipomatosis | 1 | CTD_human |
Hgene | PTEN | C0023890 | Liver Cirrhosis | 1 | CTD_human |
Hgene | PTEN | C0023976 | Long QT Syndrome | 1 | CTD_human |
Hgene | PTEN | C0024299 | Lymphoma | 1 | CTD_human |
Hgene | PTEN | C0025205 | Melanoma, Experimental | 1 | CTD_human |
Hgene | PTEN | C0025286 | Meningioma | 1 | CTD_human |
Hgene | PTEN | C0026613 | Motor Skills Disorders | 1 | CTD_human |
Hgene | PTEN | C0027055 | Myocardial Reperfusion Injury | 1 | CTD_human |
Hgene | PTEN | C0027626 | Neoplasm Invasiveness | 1 | CTD_human |
Hgene | PTEN | C0027627 | Neoplasm Metastasis | 1 | CTD_human |
Hgene | PTEN | C0030297 | Pancreatic Neoplasm | 1 | CTD_human |
Hgene | PTEN | C0035126 | Reperfusion Injury | 1 | CTD_human |
Hgene | PTEN | C0036920 | Sezary Syndrome | 1 | CTD_human |
Hgene | PTEN | C0037116 | Silicosis | 1 | CTD_human |
Hgene | PTEN | C0037274 | Dermatologic disorders | 1 | CTD_human |
Hgene | PTEN | C0149925 | Small cell carcinoma of lung | 1 | CTD_human |
Hgene | PTEN | C0152427 | Polydactyly | 1 | CTD_human |
Hgene | PTEN | C0175704 | LEOPARD Syndrome | 1 | CTD_human |
Hgene | PTEN | C0205641 | Adenocarcinoma, Basal Cell | 1 | CTD_human |
Hgene | PTEN | C0205642 | Adenocarcinoma, Oxyphilic | 1 | CTD_human |
Hgene | PTEN | C0205643 | Carcinoma, Cribriform | 1 | CTD_human |
Hgene | PTEN | C0205644 | Carcinoma, Granular Cell | 1 | CTD_human |
Hgene | PTEN | C0205645 | Adenocarcinoma, Tubular | 1 | CTD_human |
Hgene | PTEN | C0205696 | Anaplastic carcinoma | 1 | CTD_human |
Hgene | PTEN | C0205697 | Carcinoma, Spindle-Cell | 1 | CTD_human |
Hgene | PTEN | C0205698 | Undifferentiated carcinoma | 1 | CTD_human |
Hgene | PTEN | C0205699 | Carcinomatosis | 1 | CTD_human |
Hgene | PTEN | C0205788 | Histiocytoid hemangioma | 1 | CTD_human |
Hgene | PTEN | C0205789 | Hemangioma, Intramuscular | 1 | CTD_human |
Hgene | PTEN | C0205822 | Hibernoma | 1 | CTD_human |
Hgene | PTEN | C0205823 | Pleomorphic Lipoma | 1 | CTD_human |
Hgene | PTEN | C0205834 | Meningiomas, Multiple | 1 | CTD_human |
Hgene | PTEN | C0206669 | Hepatocellular Adenoma | 1 | CTD_human |
Hgene | PTEN | C0206698 | Cholangiocarcinoma | 1 | CTD_human |
Hgene | PTEN | C0235874 | Disease Exacerbation | 1 | CTD_human |
Hgene | PTEN | C0239946 | Fibrosis, Liver | 1 | CTD_human |
Hgene | PTEN | C0241210 | Speech Delay | 1 | CTD_human |
Hgene | PTEN | C0259783 | mixed gliomas | 1 | CTD_human |
Hgene | PTEN | C0259785 | Malignant Meningioma | 1 | CTD_human |
Hgene | PTEN | C0279702 | Conventional (Clear Cell) Renal Cell Carcinoma | 1 | CTD_human |
Hgene | PTEN | C0280302 | Squamous cell carcinoma of lip | 1 | ORPHANET |
Hgene | PTEN | C0280313 | Squamous cell carcinoma of oropharynx | 1 | ORPHANET |
Hgene | PTEN | C0280321 | Squamous cell carcinoma of the hypopharynx | 1 | ORPHANET |
Hgene | PTEN | C0280324 | Laryngeal Squamous Cell Carcinoma | 1 | ORPHANET |
Hgene | PTEN | C0281784 | Benign Meningioma | 1 | CTD_human |
Hgene | PTEN | C0334605 | Meningothelial meningioma | 1 | CTD_human |
Hgene | PTEN | C0334606 | Fibrous Meningioma | 1 | CTD_human |
Hgene | PTEN | C0334607 | Psammomatous Meningioma | 1 | CTD_human |
Hgene | PTEN | C0334608 | Angiomatous Meningioma | 1 | CTD_human |
Hgene | PTEN | C0334609 | Hemangioblastic Meningioma | 1 | CTD_human |
Hgene | PTEN | C0334610 | Hemangiopericytic Meningioma | 1 | CTD_human |
Hgene | PTEN | C0334611 | Transitional Meningioma | 1 | CTD_human |
Hgene | PTEN | C0345905 | Intrahepatic Cholangiocarcinoma | 1 | CTD_human |
Hgene | PTEN | C0346647 | Malignant neoplasm of pancreas | 1 | CTD_human |
Hgene | PTEN | C0347515 | Spinal Meningioma | 1 | CTD_human |
Hgene | PTEN | C0349578 | Complex Endometrial Hyperplasia | 1 | CTD_human |
Hgene | PTEN | C0349579 | Atypical Endometrial Hyperplasia | 1 | CTD_human |
Hgene | PTEN | C0349604 | Intracranial Meningioma | 1 | CTD_human |
Hgene | PTEN | C0400966 | Non-alcoholic Fatty Liver Disease | 1 | CTD_human |
Hgene | PTEN | C0431121 | Clear Cell Meningioma | 1 | CTD_human |
Hgene | PTEN | C0454655 | Semantic-Pragmatic Disorder | 1 | CTD_human |
Hgene | PTEN | C0456483 | Simple Endometrial Hyperplasia | 1 | CTD_human |
Hgene | PTEN | C0457190 | Xanthomatous Meningioma | 1 | CTD_human |
Hgene | PTEN | C0555198 | Malignant Glioma | 1 | CTD_human |
Hgene | PTEN | C0585362 | Squamous cell carcinoma of mouth | 1 | CGI;ORPHANET |
Hgene | PTEN | C0677608 | Chorioangioma | 1 | CTD_human |
Hgene | PTEN | C0677776 | Hereditary Breast and Ovarian Cancer Syndrome | 1 | ORPHANET |
Hgene | PTEN | C0751257 | Auditory Processing Disorder, Central | 1 | CTD_human |
Hgene | PTEN | C0751303 | Cerebral Convexity Meningioma | 1 | CTD_human |
Hgene | PTEN | C0751304 | Parasagittal Meningioma | 1 | CTD_human |
Hgene | PTEN | C0919267 | ovarian neoplasm | 1 | CGI;CTD_human |
Hgene | PTEN | C0920563 | Insulin Sensitivity | 1 | CTD_human |
Hgene | PTEN | C1140680 | Malignant neoplasm of ovary | 1 | CGI;CTD_human |
Hgene | PTEN | C1176475 | Ductal Carcinoma | 1 | CTD_human |
Hgene | PTEN | C1266042 | Chromophobe Renal Cell Carcinoma | 1 | CTD_human |
Hgene | PTEN | C1266043 | Sarcomatoid Renal Cell Carcinoma | 1 | CTD_human |
Hgene | PTEN | C1266044 | Collecting Duct Carcinoma of the Kidney | 1 | CTD_human |
Hgene | PTEN | C1266181 | Dysplastic gangliocytoma of cerebellum (Lhermitte-Duclos) | 1 | ORPHANET |
Hgene | PTEN | C1306837 | Papillary Renal Cell Carcinoma | 1 | CTD_human |
Hgene | PTEN | C1334261 | Intraorbital Meningioma | 1 | CTD_human |
Hgene | PTEN | C1334271 | Intraventricular Meningioma | 1 | CTD_human |
Hgene | PTEN | C1335107 | Olfactory Groove Meningioma | 1 | CTD_human |
Hgene | PTEN | C1384406 | Secretory meningioma | 1 | CTD_human |
Hgene | PTEN | C1384408 | Microcystic meningioma | 1 | CTD_human |
Hgene | PTEN | C1527197 | Angioblastic Meningioma | 1 | CTD_human |
Hgene | PTEN | C1535926 | Neurodevelopmental Disorders | 1 | CTD_human |
Hgene | PTEN | C1565950 | Posterior Fossa Meningioma | 1 | CTD_human |
Hgene | PTEN | C1565951 | Sphenoid Wing Meningioma | 1 | CTD_human |
Hgene | PTEN | C1835047 | MELANOMA, CUTANEOUS MALIGNANT, 1 | 1 | GENOMICS_ENGLAND |
Hgene | PTEN | C1959588 | Angioma | 1 | CTD_human |
Hgene | PTEN | C2239176 | Liver carcinoma | 1 | CTD_human |
Hgene | PTEN | C2711227 | Steatohepatitis | 1 | CTD_human |
Hgene | PTEN | C2931822 | Nasopharyngeal carcinoma | 1 | CTD_human |
Hgene | PTEN | C3163622 | Papillary Meningioma | 1 | CTD_human |
Hgene | PTEN | C3241937 | Nonalcoholic Steatohepatitis | 1 | CTD_human |
Hgene | PTEN | C3489413 | Lipomatosis, Multiple | 1 | CTD_human |
Hgene | PTEN | C3551915 | MENINGIOMA, FAMILIAL, SUSCEPTIBILITY TO | 1 | GENOMICS_ENGLAND |
Hgene | PTEN | C3714976 | ACTIVATED PI3K-DELTA SYNDROME | 1 | ORPHANET |
Hgene | PTEN | C3805278 | Extrahepatic Cholangiocarcinoma | 1 | CTD_human |
Hgene | PTEN | C4225426 | THYROID CANCER, NONMEDULLARY, 2 | 1 | GENOMICS_ENGLAND |
Hgene | PTEN | C4551484 | Leopard Syndrome 1 | 1 | CTD_human |
Tgene | C0266484 | Schizencephaly | 2 | GENOMICS_ENGLAND | |
Tgene | C0024121 | Lung Neoplasms | 1 | CTD_human | |
Tgene | C0036341 | Schizophrenia | 1 | PSYGENET | |
Tgene | C0242379 | Malignant neoplasm of lung | 1 | CTD_human | |
Tgene | C1720887 | Female Urogenital Diseases | 1 | CTD_human |