Fusion Gene Studies
in Kim Lab

FusionBase FusionGDB FusionGDB2 FusionPDB FusionNeoAntigen FusionAI FusionNW FGviewer Publication Contact
FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

Fusion Gene Summary

leaf

Fusion Gene ORF analysis

leaf

Fusion Genomic Features

leaf

Fusion Protein Features

leaf

Fusion Gene Sequence

leaf

Fusion Gene PPI analysis

leaf

Related Drugs

leaf

Related Diseases

Fusion gene:BCL2L2-CAPN8 (FusionGDB2 ID:HG599TG388743)

Fusion Gene Summary for BCL2L2-CAPN8

check button Fusion gene summary
Fusion gene informationFusion gene name: BCL2L2-CAPN8
Fusion gene ID: hg599tg388743
HgeneTgene
Gene symbol

BCL2L2

CAPN8

Gene ID

599

388743

Gene nameBCL2 like 2calpain 8
SynonymsBCL-W|BCL2-L-2|BCLW|PPP1R51nCL-2
Cytomap('BCL2L2')('CAPN8')

14q11.2

1q41

Type of geneprotein-codingprotein-coding
Descriptionbcl-2-like protein 2apoptosis regulator BCL-Wprotein phosphatase 1, regulatory subunit 51calpain-8new calpain 2stomach-specific M-type calpain
Modification date2020031320200313
UniProtAcc..
Ensembl transtripts involved in fusion geneENST00000250405, 
Fusion gene scores* DoF score4 X 2 X 2=1612 X 2 X 4=96
# samples 412
** MAII scorelog2(4/16*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(12/96*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: BCL2L2 [Title/Abstract] AND CAPN8 [Title/Abstract] AND fusion [Title/Abstract]

Most frequent breakpointBCL2L2(23777408)-CAPN8(223718212), # samples:1
Anticipated loss of major functional domain due to fusion event.BCL2L2-CAPN8 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF.
BCL2L2-CAPN8 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF.
BCL2L2-CAPN8 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF.
BCL2L2-CAPN8 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check buttonFusion gene breakpoints across BCL2L2 (5'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
all structure
check buttonFusion gene breakpoints across CAPN8 (3'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
all structure

check button Fusion gene information
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
SourceDiseaseSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChimerDB4STADTCGA-VQ-A8PDBCL2L2chr14

23777408

+CAPN8chr1

223718212

-


Top

Fusion Gene ORF analysis for BCL2L2-CAPN8

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5CDS-intronENST00000250405ENST00000366873BCL2L2chr14

23777408

+CAPN8chr1

223718212

-
In-frameENST00000250405ENST00000366872BCL2L2chr14

23777408

+CAPN8chr1

223718212

-

check buttonORFfinder result based on the fusion transcript sequence of in-frame fusion genes.
HenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrandSeq length
(transcript)
BP loci
(transcript)
Predicted start
(transcript)
Predicted stop
(transcript)
Seq length
(amino acids)
ENST00000250405BCL2L2chr1423777408+ENST00000366872CAPN8chr1223718212-1156661205939244

check buttonDeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated.
HenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrandNo-coding scoreCoding score
ENST00000250405ENST00000366872BCL2L2chr1423777408+CAPN8chr1223718212-0.0070707310.9929293

Top

Fusion Genomic Features for BCL2L2-CAPN8


check buttonFusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints.
HgeneHchrHbpHstrandTgeneTchrTbpTstrand1-pp (fusion gene breakpoint)

check buttonDistribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page.
genomic feature

Top

Fusion Protein Features for BCL2L2-CAPN8


check button Four levels of functional features of fusion genes
Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr14:23777408/chr1:223718212)
- FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels.
- How to search
1. Put your fusion gene symbol.
2. Press the tab key until there will be shown the breakpoint information filled.
4. Go down and press 'Search' tab twice.
4. Go down to have the hyperlink of the search result.
5. Click the hyperlink.
6. See the FGviewer result for your fusion gene.
FGviewer

check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
..
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}.FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page


* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBCL2L2chr14:23777408chr1:223718212ENST00000250405+3485_104144194.0MotifNote=BH1
HgeneBCL2L2chr14:23777408chr1:223718212ENST00000250405+349_29144194.0MotifNote=BH4
TgeneCAPN8chr14:23777408chr1:223718212ENST000003668721520588_599589682.0Calcium binding1
TgeneCAPN8chr14:23777408chr1:223718212ENST000003668721520618_629589682.0Calcium binding2
TgeneCAPN8chr14:23777408chr1:223718212ENST000003668721520605_640589682.0DomainEF-hand 2
TgeneCAPN8chr14:23777408chr1:223718212ENST000003668721520670_703589682.0DomainEF-hand 3

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBCL2L2chr14:23777408chr1:223718212ENST00000250405+34136_151144194.0MotifNote=BH2
TgeneCAPN8chr14:23777408chr1:223718212ENST00000366872152045_344589682.0DomainCalpain catalytic
TgeneCAPN8chr14:23777408chr1:223718212ENST000003668721520575_610589682.0DomainEF-hand 1
TgeneCAPN8chr14:23777408chr1:223718212ENST000003668721520356_379589682.0RegionNote=Domain III


Top

Fusion Gene Sequence for BCL2L2-CAPN8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones.
>9384_9384_1_BCL2L2-CAPN8_BCL2L2_chr14_23777408_ENST00000250405_CAPN8_chr1_223718212_ENST00000366872_length(transcript)=1156nt_BP=661nt
ATCACCCGGCGCCGGGCCCTCCCTCTGCCCCCCCCTTTCTCCTCCCTCCTTCCTTCCCTCCCTTCCTCCCTCTCTCCCTCCCTCCCAGCT
CCTGCACCAGGAAACGGCCCGGATCCCGGCAGCGGCCTGACCCGGCTCCACGCTGGCCAGGAGGATGAAAGGCCCCAGCTGGGGGCTCCT
TGCCACCAGTGCTGTGTCTTAAGAGCTGCCATCCCGGCTGGCCGCCCGGATGGCGACCCCAGCCTCGGCCCCAGACACACGGGCTCTGGT
GGCAGACTTTGTAGGTTATAAGCTGAGGCAGAAGGGTTATGTCTGTGGAGCTGGCCCCGGGGAGGGCCCAGCAGCTGACCCGCTGCACCA
AGCCATGCGGGCAGCTGGAGATGAGTTCGAGACCCGCTTCCGGCGCACCTTCTCTGATCTGGCGGCTCAGCTGCATGTGACCCCAGGCTC
AGCCCAACAACGCTTCACCCAGGTCTCCGATGAACTTTTTCAAGGGGGCCCCAACTGGGGCCGCCTTGTAGCCTTCTTTGTCTTTGGGGC
TGCACTGTGTGCTGAGAGTGTCAACAAGGAGATGGAACCACTGGTGGGACAAGTGCAGGAGTGGATGGTGGCCTACCTGGAGACGCAGCT
GGCTGACTGGATCCACAGCAGTGGGGGCTGGGAGATCTATTGGGAAACTGATTATAACCACTCGGGCACCATCGATGCCCACGAGATGAG
GACAGCCCTCAGGAAGGCAGGTTTCACCCTCAACAGCCAGGTGCAGCAGACCATTGCCCTGCGGTATGCGTGCAGCAAGCTCGGCATCAA
CTTTGACAGCTTCGTGGCTTGTATGATCCGCCTGGAGACCCTCTTCAAACTATTCAGCCTTCTGGACGAAGACAAGGATGGCATGGTTCA
GCTCTCTCTGGCCGAGTGGCTGTGCTGCGTGTTGGTCTGACCCGGGGTTTCGGACATCAGTGACACTCCCTGCCCCACTGCTTGCTTCTT
GTCACCCCTTCTCTACAATTTTGTGAACATTTATGCTCCAGTGGCATTCACTGGTTGTTCATACCTTTCTTGCCCTGGGTCTATTTCAGC
AGCACTGAGCTATGAGCTATGTAAGCCGACCCGGTGGGCCCAGTGGAGGGAAAGCAATCAATTAAAGTTGTGAGCC

>9384_9384_1_BCL2L2-CAPN8_BCL2L2_chr14_23777408_ENST00000250405_CAPN8_chr1_223718212_ENST00000366872_length(amino acids)=244AA_BP=152
MPSRLAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQV
SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWEIYWETDYNHSGTIDAHEMRTALRKAGF
TLNSQVQQTIALRYACSKLGINFDSFVACMIRLETLFKLFSLLDEDKDGMVQLSLAEWLCCVLV

--------------------------------------------------------------

Top

Fusion Gene PPI Analysis for BCL2L2-CAPN8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page.


check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

Related Drugs for BCL2L2-CAPN8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.8 2021-05-08)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

Related Diseases for BCL2L2-CAPN8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneC0007570Celiac Disease1CTD_human