|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:CAT-ANXA2 (FusionGDB2 ID:HG847TG302) |
Fusion Gene Summary for CAT-ANXA2 |
Fusion gene summary |
Fusion gene information | Fusion gene name: CAT-ANXA2 | Fusion gene ID: hg847tg302 | Hgene | Tgene | Gene symbol | CAT | ANXA2 | Gene ID | 847 | 302 |
Gene name | catalase | annexin A2 | |
Synonyms | - | ANX2|ANX2L4|CAL1H|HEL-S-270|LIP2|LPC2|LPC2D|P36|PAP-IV | |
Cytomap | ('CAT')('ANXA2') 11p13 | 15q22.2 | |
Type of gene | protein-coding | protein-coding | |
Description | catalaseepididymis secretory sperm binding protein | annexin A2annexin IIannexin-2calpactin I heavy chaincalpactin I heavy polypeptidecalpactin-1 heavy chainchromobindin 8epididymis secretory protein Li 270epididymis secretory sperm binding proteinlipocortin IIplacental anticoagulant protein IVpr | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | P04040 | . | |
Ensembl transtripts involved in fusion gene | ENST00000241052, ENST00000534710, | ||
Fusion gene scores | * DoF score | 5 X 5 X 4=100 | 33 X 12 X 13=5148 |
# samples | 5 | 39 | |
** MAII score | log2(5/100*10)=-1 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(39/5148*10)=-3.72246602447109 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: CAT [Title/Abstract] AND ANXA2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | CAT(34460626)-ANXA2(60646412), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | CAT-ANXA2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CAT-ANXA2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CAT | GO:0042744 | hydrogen peroxide catabolic process | 18379038 |
Tgene | ANXA2 | GO:0001921 | positive regulation of receptor recycling | 22848640 |
Tgene | ANXA2 | GO:0031340 | positive regulation of vesicle fusion | 2138016 |
Tgene | ANXA2 | GO:0032804 | negative regulation of low-density lipoprotein particle receptor catabolic process | 22848640 |
Tgene | ANXA2 | GO:0036035 | osteoclast development | 7961821 |
Tgene | ANXA2 | GO:1905581 | positive regulation of low-density lipoprotein particle clearance | 22848640 |
Tgene | ANXA2 | GO:1905597 | positive regulation of low-density lipoprotein particle receptor binding | 22848640 |
Tgene | ANXA2 | GO:1905602 | positive regulation of receptor-mediated endocytosis involved in cholesterol transport | 22848640 |
Fusion gene breakpoints across CAT (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across ANXA2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-CG-5724-01A | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - |
Top |
Fusion Gene ORF analysis for CAT-ANXA2 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000241052 | ENST00000557937 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - |
In-frame | ENST00000241052 | ENST00000332680 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - |
In-frame | ENST00000241052 | ENST00000396024 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - |
In-frame | ENST00000241052 | ENST00000421017 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - |
In-frame | ENST00000241052 | ENST00000451270 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - |
intron-3CDS | ENST00000534710 | ENST00000332680 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - |
intron-3CDS | ENST00000534710 | ENST00000396024 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - |
intron-3CDS | ENST00000534710 | ENST00000421017 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - |
intron-3CDS | ENST00000534710 | ENST00000451270 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - |
intron-intron | ENST00000534710 | ENST00000557937 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000241052 | CAT | chr11 | 34460626 | + | ENST00000396024 | ANXA2 | chr15 | 60646412 | - | 1143 | 155 | 781 | 2 | 260 |
ENST00000241052 | CAT | chr11 | 34460626 | + | ENST00000451270 | ANXA2 | chr15 | 60646412 | - | 950 | 155 | 781 | 2 | 260 |
ENST00000241052 | CAT | chr11 | 34460626 | + | ENST00000332680 | ANXA2 | chr15 | 60646412 | - | 945 | 155 | 781 | 2 | 260 |
ENST00000241052 | CAT | chr11 | 34460626 | + | ENST00000421017 | ANXA2 | chr15 | 60646412 | - | 935 | 155 | 781 | 2 | 260 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000241052 | ENST00000396024 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - | 0.001875872 | 0.99812406 |
ENST00000241052 | ENST00000451270 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - | 0.001675769 | 0.9983242 |
ENST00000241052 | ENST00000332680 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - | 0.001783023 | 0.9982169 |
ENST00000241052 | ENST00000421017 | CAT | chr11 | 34460626 | + | ANXA2 | chr15 | 60646412 | - | 0.001807005 | 0.99819297 |
Top |
Fusion Genomic Features for CAT-ANXA2 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Top |
Fusion Protein Features for CAT-ANXA2 |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr11:34460626/chr15:60646412) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
CAT | . |
FUNCTION: Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide. Promotes growth of cells including T-cells, B-cells, myeloid leukemia cells, melanoma cells, mastocytoma cells and normal and transformed fibroblast cells. {ECO:0000269|PubMed:7882369}. | FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000332680 | 6 | 13 | 265_336 | 194 | 358.0 | Repeat | Annexin 4 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000396024 | 7 | 14 | 189_261 | 176 | 340.0 | Repeat | Annexin 3 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000396024 | 7 | 14 | 265_336 | 176 | 340.0 | Repeat | Annexin 4 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000421017 | 7 | 14 | 189_261 | 176 | 340.0 | Repeat | Annexin 3 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000421017 | 7 | 14 | 265_336 | 176 | 340.0 | Repeat | Annexin 4 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000451270 | 6 | 13 | 189_261 | 176 | 340.0 | Repeat | Annexin 3 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000451270 | 6 | 13 | 265_336 | 176 | 340.0 | Repeat | Annexin 4 |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000332680 | 6 | 13 | 2_24 | 194 | 358.0 | Region | S100A10-binding site | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000396024 | 7 | 14 | 2_24 | 176 | 340.0 | Region | S100A10-binding site | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000421017 | 7 | 14 | 2_24 | 176 | 340.0 | Region | S100A10-binding site | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000451270 | 6 | 13 | 2_24 | 176 | 340.0 | Region | S100A10-binding site | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000332680 | 6 | 13 | 105_176 | 194 | 358.0 | Repeat | Annexin 2 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000332680 | 6 | 13 | 189_261 | 194 | 358.0 | Repeat | Annexin 3 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000332680 | 6 | 13 | 33_104 | 194 | 358.0 | Repeat | Annexin 1 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000396024 | 7 | 14 | 105_176 | 176 | 340.0 | Repeat | Annexin 2 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000396024 | 7 | 14 | 33_104 | 176 | 340.0 | Repeat | Annexin 1 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000421017 | 7 | 14 | 105_176 | 176 | 340.0 | Repeat | Annexin 2 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000421017 | 7 | 14 | 33_104 | 176 | 340.0 | Repeat | Annexin 1 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000451270 | 6 | 13 | 105_176 | 176 | 340.0 | Repeat | Annexin 2 | |
Tgene | ANXA2 | chr11:34460626 | chr15:60646412 | ENST00000451270 | 6 | 13 | 33_104 | 176 | 340.0 | Repeat | Annexin 1 |
Top |
Fusion Gene Sequence for CAT-ANXA2 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>13296_13296_1_CAT-ANXA2_CAT_chr11_34460626_ENST00000241052_ANXA2_chr15_60646412_ENST00000332680_length(transcript)=945nt_BP=155nt ACTCGGGGCAACAGGCAGATTTGCCTGCTGAGGGTGGAGACCCACGAGCCGAGGCCTCCTGCAGTGTTCTGCACAGCAAACCGCACGCTA TGGCTGACAGCCGGGATCCCGCCAGCGACCAGATGCAGCACTGGAAGGAGCAGCGGGCCGCGCAGGGTAGAAGAGCAGAGGATGGCTCTG TCATTGATTATGAACTGATTGACCAAGATGCTCGGGATCTCTATGACGCTGGAGTGAAGAGGAAAGGAACTGATGTTCCCAAGTGGATCA GCATCATGACCGAGCGGAGCGTGCCCCACCTCCAGAAAGTATTTGATAGGTACAAGAGTTACAGCCCTTATGACATGTTGGAAAGCATCA GGAAAGAGGTTAAAGGAGACCTGGAAAATGCTTTCCTGAACCTGGTTCAGTGCATTCAGAACAAGCCCCTGTATTTTGCTGATCGGCTGT ATGACTCCATGAAGGGCAAGGGGACGCGAGATAAGGTCCTGATCAGAATCATGGTCTCCCGCAGTGAAGTGGACATGTTGAAAATTAGGT CTGAATTCAAGAGAAAGTACGGCAAGTCCCTGTACTATTATATCCAGCAAGACACTAAGGGCGACTACCAGAAAGCGCTGCTGTACCTGT GTGGTGGAGATGACTGAAGCCCGACACGGCCTGAGCGTCCAGAAATGGTGCTCACCATGCTTCCAGCTAACAGGTCTAGAAAACCAGCTT GCGAATAACAGTCCCCGTGGCCATCCCTGTGAGGGTGACGTTAGCATTACCCCCAACCTCATTTTAGTTGCCTAAGCATTGCCTGGCCTT CCTGTCTAGTCTCTCCTGTAAGCCAAAGAAATGAACATTCCAAGGAGTTGGAAGTGAAGTCTATGATGTGAAACACTTTGCCTCCTGTGT >13296_13296_1_CAT-ANXA2_CAT_chr11_34460626_ENST00000241052_ANXA2_chr15_60646412_ENST00000332680_length(amino acids)=260AA_BP=0 MRLGVMLTSPSQGWPRGLLFASWFSRPVSWKHGEHHFWTLRPCRASVISTTQVQQRFLVVALSVLLDIIVQGLAVLSLEFRPNFQHVHFT AGDHDSDQDLISRPLALHGVIQPISKIQGLVLNALNQVQESIFQVSFNLFPDAFQHVIRAVTLVPIKYFLEVGHAPLGHDADPLGNISSF -------------------------------------------------------------- >13296_13296_2_CAT-ANXA2_CAT_chr11_34460626_ENST00000241052_ANXA2_chr15_60646412_ENST00000396024_length(transcript)=1143nt_BP=155nt ACTCGGGGCAACAGGCAGATTTGCCTGCTGAGGGTGGAGACCCACGAGCCGAGGCCTCCTGCAGTGTTCTGCACAGCAAACCGCACGCTA TGGCTGACAGCCGGGATCCCGCCAGCGACCAGATGCAGCACTGGAAGGAGCAGCGGGCCGCGCAGGGTAGAAGAGCAGAGGATGGCTCTG TCATTGATTATGAACTGATTGACCAAGATGCTCGGGATCTCTATGACGCTGGAGTGAAGAGGAAAGGAACTGATGTTCCCAAGTGGATCA GCATCATGACCGAGCGGAGCGTGCCCCACCTCCAGAAAGTATTTGATAGGTACAAGAGTTACAGCCCTTATGACATGTTGGAAAGCATCA GGAAAGAGGTTAAAGGAGACCTGGAAAATGCTTTCCTGAACCTGGTTCAGTGCATTCAGAACAAGCCCCTGTATTTTGCTGATCGGCTGT ATGACTCCATGAAGGGCAAGGGGACGCGAGATAAGGTCCTGATCAGAATCATGGTCTCCCGCAGTGAAGTGGACATGTTGAAAATTAGGT CTGAATTCAAGAGAAAGTACGGCAAGTCCCTGTACTATTATATCCAGCAAGACACTAAGGGCGACTACCAGAAAGCGCTGCTGTACCTGT GTGGTGGAGATGACTGAAGCCCGACACGGCCTGAGCGTCCAGAAATGGTGCTCACCATGCTTCCAGCTAACAGGTCTAGAAAACCAGCTT GCGAATAACAGTCCCCGTGGCCATCCCTGTGAGGGTGACGTTAGCATTACCCCCAACCTCATTTTAGTTGCCTAAGCATTGCCTGGCCTT CCTGTCTAGTCTCTCCTGTAAGCCAAAGAAATGAACATTCCAAGGAGTTGGAAGTGAAGTCTATGATGTGAAACACTTTGCCTCCTGTGT ACTGTGTCATAAACAGATGAATAAACTGAATTTGTACTTTAGAAACACGTACTTTGTGGCCCTGCTTTCAACTGAATTGTTTGAAAATTA AACGTGCTTGGGGTTCAGCTGGTGAGGCTGTCCCTGTAGGAAGAAAGCTCTGGGACTGAGCTGTACAGTATGGTTGCCCCTATCCAAGTG >13296_13296_2_CAT-ANXA2_CAT_chr11_34460626_ENST00000241052_ANXA2_chr15_60646412_ENST00000396024_length(amino acids)=260AA_BP=0 MRLGVMLTSPSQGWPRGLLFASWFSRPVSWKHGEHHFWTLRPCRASVISTTQVQQRFLVVALSVLLDIIVQGLAVLSLEFRPNFQHVHFT AGDHDSDQDLISRPLALHGVIQPISKIQGLVLNALNQVQESIFQVSFNLFPDAFQHVIRAVTLVPIKYFLEVGHAPLGHDADPLGNISSF -------------------------------------------------------------- >13296_13296_3_CAT-ANXA2_CAT_chr11_34460626_ENST00000241052_ANXA2_chr15_60646412_ENST00000421017_length(transcript)=935nt_BP=155nt ACTCGGGGCAACAGGCAGATTTGCCTGCTGAGGGTGGAGACCCACGAGCCGAGGCCTCCTGCAGTGTTCTGCACAGCAAACCGCACGCTA TGGCTGACAGCCGGGATCCCGCCAGCGACCAGATGCAGCACTGGAAGGAGCAGCGGGCCGCGCAGGGTAGAAGAGCAGAGGATGGCTCTG TCATTGATTATGAACTGATTGACCAAGATGCTCGGGATCTCTATGACGCTGGAGTGAAGAGGAAAGGAACTGATGTTCCCAAGTGGATCA GCATCATGACCGAGCGGAGCGTGCCCCACCTCCAGAAAGTATTTGATAGGTACAAGAGTTACAGCCCTTATGACATGTTGGAAAGCATCA GGAAAGAGGTTAAAGGAGACCTGGAAAATGCTTTCCTGAACCTGGTTCAGTGCATTCAGAACAAGCCCCTGTATTTTGCTGATCGGCTGT ATGACTCCATGAAGGGCAAGGGGACGCGAGATAAGGTCCTGATCAGAATCATGGTCTCCCGCAGTGAAGTGGACATGTTGAAAATTAGGT CTGAATTCAAGAGAAAGTACGGCAAGTCCCTGTACTATTATATCCAGCAAGACACTAAGGGCGACTACCAGAAAGCGCTGCTGTACCTGT GTGGTGGAGATGACTGAAGCCCGACACGGCCTGAGCGTCCAGAAATGGTGCTCACCATGCTTCCAGCTAACAGGTCTAGAAAACCAGCTT GCGAATAACAGTCCCCGTGGCCATCCCTGTGAGGGTGACGTTAGCATTACCCCCAACCTCATTTTAGTTGCCTAAGCATTGCCTGGCCTT CCTGTCTAGTCTCTCCTGTAAGCCAAAGAAATGAACATTCCAAGGAGTTGGAAGTGAAGTCTATGATGTGAAACACTTTGCCTCCTGTGT >13296_13296_3_CAT-ANXA2_CAT_chr11_34460626_ENST00000241052_ANXA2_chr15_60646412_ENST00000421017_length(amino acids)=260AA_BP=0 MRLGVMLTSPSQGWPRGLLFASWFSRPVSWKHGEHHFWTLRPCRASVISTTQVQQRFLVVALSVLLDIIVQGLAVLSLEFRPNFQHVHFT AGDHDSDQDLISRPLALHGVIQPISKIQGLVLNALNQVQESIFQVSFNLFPDAFQHVIRAVTLVPIKYFLEVGHAPLGHDADPLGNISSF -------------------------------------------------------------- >13296_13296_4_CAT-ANXA2_CAT_chr11_34460626_ENST00000241052_ANXA2_chr15_60646412_ENST00000451270_length(transcript)=950nt_BP=155nt ACTCGGGGCAACAGGCAGATTTGCCTGCTGAGGGTGGAGACCCACGAGCCGAGGCCTCCTGCAGTGTTCTGCACAGCAAACCGCACGCTA TGGCTGACAGCCGGGATCCCGCCAGCGACCAGATGCAGCACTGGAAGGAGCAGCGGGCCGCGCAGGGTAGAAGAGCAGAGGATGGCTCTG TCATTGATTATGAACTGATTGACCAAGATGCTCGGGATCTCTATGACGCTGGAGTGAAGAGGAAAGGAACTGATGTTCCCAAGTGGATCA GCATCATGACCGAGCGGAGCGTGCCCCACCTCCAGAAAGTATTTGATAGGTACAAGAGTTACAGCCCTTATGACATGTTGGAAAGCATCA GGAAAGAGGTTAAAGGAGACCTGGAAAATGCTTTCCTGAACCTGGTTCAGTGCATTCAGAACAAGCCCCTGTATTTTGCTGATCGGCTGT ATGACTCCATGAAGGGCAAGGGGACGCGAGATAAGGTCCTGATCAGAATCATGGTCTCCCGCAGTGAAGTGGACATGTTGAAAATTAGGT CTGAATTCAAGAGAAAGTACGGCAAGTCCCTGTACTATTATATCCAGCAAGACACTAAGGGCGACTACCAGAAAGCGCTGCTGTACCTGT GTGGTGGAGATGACTGAAGCCCGACACGGCCTGAGCGTCCAGAAATGGTGCTCACCATGCTTCCAGCTAACAGGTCTAGAAAACCAGCTT GCGAATAACAGTCCCCGTGGCCATCCCTGTGAGGGTGACGTTAGCATTACCCCCAACCTCATTTTAGTTGCCTAAGCATTGCCTGGCCTT CCTGTCTAGTCTCTCCTGTAAGCCAAAGAAATGAACATTCCAAGGAGTTGGAAGTGAAGTCTATGATGTGAAACACTTTGCCTCCTGTGT >13296_13296_4_CAT-ANXA2_CAT_chr11_34460626_ENST00000241052_ANXA2_chr15_60646412_ENST00000451270_length(amino acids)=260AA_BP=0 MRLGVMLTSPSQGWPRGLLFASWFSRPVSWKHGEHHFWTLRPCRASVISTTQVQQRFLVVALSVLLDIIVQGLAVLSLEFRPNFQHVHFT AGDHDSDQDLISRPLALHGVIQPISKIQGLVLNALNQVQESIFQVSFNLFPDAFQHVIRAVTLVPIKYFLEVGHAPLGHDADPLGNISSF -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for CAT-ANXA2 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for CAT-ANXA2 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Hgene | CAT | P04040 | DB09061 | Cannabidiol | Inhibitor | Small molecule | Approved|Investigational |
Hgene | CAT | P04040 | DB01213 | Fomepizole | Inhibitor | Small molecule | Approved|Vet_approved |
Top |
Related Diseases for CAT-ANXA2 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | CAT | C0268419 | Acatalasia | 7 | CTD_human;GENOMICS_ENGLAND;ORPHANET |
Hgene | CAT | C0007621 | Neoplastic Cell Transformation | 6 | CTD_human |
Hgene | CAT | C0752048 | Hypocatalasemia | 5 | CTD_human |
Hgene | CAT | C2931868 | Catalase deficiency | 5 | CTD_human;ORPHANET |
Hgene | CAT | C2936847 | Acatalasemia Japanese type | 5 | CTD_human |
Hgene | CAT | C2936848 | Acatalasemia Swiss type | 5 | CTD_human |
Hgene | CAT | C0020538 | Hypertensive disease | 4 | CTD_human |
Hgene | CAT | C0035126 | Reperfusion Injury | 4 | CTD_human |
Hgene | CAT | C0038220 | Status Epilepticus | 4 | CTD_human |
Hgene | CAT | C0270823 | Petit mal status | 4 | CTD_human |
Hgene | CAT | C0311335 | Grand Mal Status Epilepticus | 4 | CTD_human |
Hgene | CAT | C0393734 | Complex Partial Status Epilepticus | 4 | CTD_human |
Hgene | CAT | C0751522 | Status Epilepticus, Subclinical | 4 | CTD_human |
Hgene | CAT | C0751523 | Non-Convulsive Status Epilepticus | 4 | CTD_human |
Hgene | CAT | C0751524 | Simple Partial Status Epilepticus | 4 | CTD_human |
Hgene | CAT | C0002152 | Alloxan Diabetes | 3 | CTD_human |
Hgene | CAT | C0011853 | Diabetes Mellitus, Experimental | 3 | CTD_human |
Hgene | CAT | C0022333 | Jacksonian Seizure | 3 | CTD_human |
Hgene | CAT | C0027627 | Neoplasm Metastasis | 3 | CTD_human |
Hgene | CAT | C0036572 | Seizures | 3 | CTD_human |
Hgene | CAT | C0038433 | Streptozotocin Diabetes | 3 | CTD_human |
Hgene | CAT | C0149958 | Complex partial seizures | 3 | CTD_human |
Hgene | CAT | C0234533 | Generalized seizures | 3 | CTD_human |
Hgene | CAT | C0234535 | Clonic Seizures | 3 | CTD_human |
Hgene | CAT | C0235874 | Disease Exacerbation | 3 | CTD_human |
Hgene | CAT | C0270824 | Visual seizure | 3 | CTD_human |
Hgene | CAT | C0270844 | Tonic Seizures | 3 | CTD_human |
Hgene | CAT | C0270846 | Epileptic drop attack | 3 | CTD_human |
Hgene | CAT | C0422850 | Seizures, Somatosensory | 3 | CTD_human |
Hgene | CAT | C0422852 | Seizures, Auditory | 3 | CTD_human |
Hgene | CAT | C0422853 | Olfactory seizure | 3 | CTD_human |
Hgene | CAT | C0422854 | Gustatory seizure | 3 | CTD_human |
Hgene | CAT | C0422855 | Vertiginous seizure | 3 | CTD_human |
Hgene | CAT | C0494475 | Tonic - clonic seizures | 3 | CTD_human |
Hgene | CAT | C0751056 | Non-epileptic convulsion | 3 | CTD_human |
Hgene | CAT | C0751110 | Single Seizure | 3 | CTD_human |
Hgene | CAT | C0751123 | Atonic Absence Seizures | 3 | CTD_human |
Hgene | CAT | C0751494 | Convulsive Seizures | 3 | CTD_human |
Hgene | CAT | C0751495 | Seizures, Focal | 3 | CTD_human |
Hgene | CAT | C0751496 | Seizures, Sensory | 3 | CTD_human |
Hgene | CAT | C3495874 | Nonepileptic Seizures | 3 | CTD_human |
Hgene | CAT | C4048158 | Convulsions | 3 | CTD_human |
Hgene | CAT | C4316903 | Absence Seizures | 3 | CTD_human |
Hgene | CAT | C4317109 | Epileptic Seizures | 3 | CTD_human |
Hgene | CAT | C4317123 | Myoclonic Seizures | 3 | CTD_human |
Hgene | CAT | C4505436 | Generalized Absence Seizures | 3 | CTD_human |
Hgene | CAT | C0000771 | Abnormalities, Drug-Induced | 2 | CTD_human |
Hgene | CAT | C0001973 | Alcoholic Intoxication, Chronic | 2 | PSYGENET |
Hgene | CAT | C0011860 | Diabetes Mellitus, Non-Insulin-Dependent | 2 | CTD_human |
Hgene | CAT | C0019193 | Hepatitis, Toxic | 2 | CTD_human |
Hgene | CAT | C0022661 | Kidney Failure, Chronic | 2 | CTD_human |
Hgene | CAT | C0027540 | Necrosis | 2 | CTD_human |
Hgene | CAT | C0027626 | Neoplasm Invasiveness | 2 | CTD_human |
Hgene | CAT | C0860207 | Drug-Induced Liver Disease | 2 | CTD_human |
Hgene | CAT | C1262760 | Hepatitis, Drug-Induced | 2 | CTD_human |
Hgene | CAT | C1269683 | Major Depressive Disorder | 2 | CTD_human;PSYGENET |
Hgene | CAT | C3658290 | Drug-Induced Acute Liver Injury | 2 | CTD_human |
Hgene | CAT | C4277682 | Chemical and Drug Induced Liver Injury | 2 | CTD_human |
Hgene | CAT | C4279912 | Chemically-Induced Liver Toxicity | 2 | CTD_human |
Hgene | CAT | C0003493 | Aortic Diseases | 1 | CTD_human |
Hgene | CAT | C0003865 | Arthritis, Adjuvant-Induced | 1 | CTD_human |
Hgene | CAT | C0003873 | Rheumatoid Arthritis | 1 | CTD_human |
Hgene | CAT | C0004045 | Asphyxia Neonatorum | 1 | CTD_human |
Hgene | CAT | C0004096 | Asthma | 1 | CTD_human |
Hgene | CAT | C0004352 | Autistic Disorder | 1 | CTD_human |
Hgene | CAT | C0004943 | Behcet Syndrome | 1 | CTD_human |
Hgene | CAT | C0006142 | Malignant neoplasm of breast | 1 | CTD_human |
Hgene | CAT | C0006826 | Malignant Neoplasms | 1 | CTD_human |
Hgene | CAT | C0007131 | Non-Small Cell Lung Carcinoma | 1 | CTD_human |
Hgene | CAT | C0007786 | Brain Ischemia | 1 | CTD_human |
Hgene | CAT | C0008370 | Cholestasis | 1 | CTD_human |
Hgene | CAT | C0008909 | Claustrophobia | 1 | CTD_human |
Hgene | CAT | C0011574 | Involutional Depression | 1 | CTD_human |
Hgene | CAT | C0011849 | Diabetes Mellitus | 1 | CTD_human |
Hgene | CAT | C0011854 | Diabetes Mellitus, Insulin-Dependent | 1 | CTD_human |
Hgene | CAT | C0011882 | Diabetic Neuropathies | 1 | CTD_human |
Hgene | CAT | C0013386 | Dyskinesia, Drug-Induced | 1 | CTD_human |
Hgene | CAT | C0013604 | Edema | 1 | CTD_human |
Hgene | CAT | C0015695 | Fatty Liver | 1 | CTD_human |
Hgene | CAT | C0015923 | Fetal Alcohol Syndrome | 1 | CTD_human |
Hgene | CAT | C0017638 | Glioma | 1 | CTD_human |
Hgene | CAT | C0018801 | Heart failure | 1 | CTD_human |
Hgene | CAT | C0018802 | Congestive heart failure | 1 | CTD_human |
Hgene | CAT | C0019158 | Hepatitis | 1 | CTD_human |
Hgene | CAT | C0019189 | Hepatitis, Chronic | 1 | CTD_human |
Hgene | CAT | C0020452 | Hyperemia | 1 | CTD_human |
Hgene | CAT | C0020550 | Hyperthyroidism | 1 | CTD_human |
Hgene | CAT | C0020649 | Hypotension | 1 | CTD_human |
Hgene | CAT | C0022593 | Keratosis | 1 | CTD_human |
Hgene | CAT | C0022594 | Keratosis Blennorrhagica | 1 | CTD_human |
Hgene | CAT | C0022650 | Kidney Calculi | 1 | CTD_human |
Hgene | CAT | C0023212 | Left-Sided Heart Failure | 1 | CTD_human |
Hgene | CAT | C0023891 | Liver Cirrhosis, Alcoholic | 1 | CTD_human |
Hgene | CAT | C0024141 | Lupus Erythematosus, Systemic | 1 | CTD_human |
Hgene | CAT | C0024796 | Marfan Syndrome | 1 | CTD_human |
Hgene | CAT | C0025500 | Mesothelioma | 1 | CTD_human |
Hgene | CAT | C0027051 | Myocardial Infarction | 1 | CTD_human |
Hgene | CAT | C0027055 | Myocardial Reperfusion Injury | 1 | CTD_human |
Hgene | CAT | C0027651 | Neoplasms | 1 | CTD_human |
Hgene | CAT | C0029458 | Osteoporosis, Postmenopausal | 1 | CTD_human |
Hgene | CAT | C0030246 | Pustulosis of Palms and Soles | 1 | CTD_human |
Hgene | CAT | C0032927 | Precancerous Conditions | 1 | CTD_human |
Hgene | CAT | C0033141 | Cardiomyopathies, Primary | 1 | CTD_human |
Hgene | CAT | C0033626 | Protein Deficiency | 1 | CTD_human |
Hgene | CAT | C0033860 | Psoriasis | 1 | CTD_human |
Hgene | CAT | C0034063 | Pulmonary Edema | 1 | CTD_human |
Hgene | CAT | C0034065 | Pulmonary Embolism | 1 | CTD_human |
Hgene | CAT | C0034069 | Pulmonary Fibrosis | 1 | CTD_human |
Hgene | CAT | C0036529 | Myocardial Diseases, Secondary | 1 | CTD_human |
Hgene | CAT | C0038358 | Gastric ulcer | 1 | CTD_human |
Hgene | CAT | C0041408 | Turner Syndrome | 1 | CTD_human |
Hgene | CAT | C0041696 | Unipolar Depression | 1 | PSYGENET |
Hgene | CAT | C0042484 | Venous Engorgement | 1 | CTD_human |
Hgene | CAT | C0079744 | Diffuse Large B-Cell Lymphoma | 1 | CTD_human |
Hgene | CAT | C0086501 | Keratoma | 1 | CTD_human |
Hgene | CAT | C0086692 | Benign Neoplasm | 1 | CTD_human |
Hgene | CAT | C0149519 | Chronic Persistent Hepatitis | 1 | CTD_human |
Hgene | CAT | C0151526 | Premature Birth | 1 | CTD_human |
Hgene | CAT | C0151603 | Anasarca | 1 | CTD_human |
Hgene | CAT | C0178824 | Reactive Hyperemia | 1 | CTD_human |
Hgene | CAT | C0205734 | Diabetes, Autoimmune | 1 | CTD_human |
Hgene | CAT | C0235527 | Heart Failure, Right-Sided | 1 | CTD_human |
Hgene | CAT | C0242380 | Libman-Sacks Disease | 1 | CTD_human |
Hgene | CAT | C0242488 | Acute Lung Injury | 1 | CTD_human |
Hgene | CAT | C0242526 | Gonadal Dysgenesis, 45,X | 1 | CTD_human |
Hgene | CAT | C0259783 | mixed gliomas | 1 | CTD_human |
Hgene | CAT | C0271673 | Symmetric Diabetic Proximal Motor Neuropathy | 1 | CTD_human |
Hgene | CAT | C0271674 | Asymmetric Diabetic Proximal Motor Neuropathy | 1 | CTD_human |
Hgene | CAT | C0271678 | Diabetic Mononeuropathy | 1 | CTD_human |
Hgene | CAT | C0271680 | Diabetic Polyneuropathies | 1 | CTD_human |
Hgene | CAT | C0271685 | Diabetic Amyotrophy | 1 | CTD_human |
Hgene | CAT | C0271686 | Diabetic Autonomic Neuropathy | 1 | CTD_human |
Hgene | CAT | C0282313 | Condition, Preneoplastic | 1 | CTD_human |
Hgene | CAT | C0333233 | Active Hyperemia | 1 | CTD_human |
Hgene | CAT | C0333704 | Chromosome Breaks | 1 | CTD_human |
Hgene | CAT | C0342302 | Brittle diabetes | 1 | CTD_human |
Hgene | CAT | C0349231 | Phobic anxiety disorder | 1 | CTD_human |
Hgene | CAT | C0376628 | Chromosome Breakage | 1 | CTD_human |
Hgene | CAT | C0393835 | Diabetic Asymmetric Polyneuropathy | 1 | CTD_human |
Hgene | CAT | C0400966 | Non-alcoholic Fatty Liver Disease | 1 | CTD_human |
Hgene | CAT | C0520463 | Chronic active hepatitis | 1 | CTD_human |
Hgene | CAT | C0524611 | Cryptogenic Chronic Hepatitis | 1 | CTD_human |
Hgene | CAT | C0524702 | Pulmonary Thromboembolisms | 1 | CTD_human |
Hgene | CAT | C0555198 | Malignant Glioma | 1 | CTD_human |
Hgene | CAT | C0678222 | Breast Carcinoma | 1 | CTD_human |
Hgene | CAT | C0751074 | Diabetic Neuralgia | 1 | CTD_human |
Hgene | CAT | C0751088 | Dyskinesia, Medication-Induced | 1 | CTD_human |
Hgene | CAT | C0814154 | Alcohol Related Neurodevelopmental Disorder | 1 | CTD_human |
Hgene | CAT | C0878544 | Cardiomyopathies | 1 | CTD_human |
Hgene | CAT | C0917798 | Cerebral Ischemia | 1 | CTD_human |
Hgene | CAT | C0971858 | Arthritis, Collagen-Induced | 1 | CTD_human |
Hgene | CAT | C0993582 | Arthritis, Experimental | 1 | CTD_human |
Hgene | CAT | C1257931 | Mammary Neoplasms, Human | 1 | CTD_human |
Hgene | CAT | C1456865 | Ureteral Calculi | 1 | CTD_human |
Hgene | CAT | C1458155 | Mammary Neoplasms | 1 | CTD_human |
Hgene | CAT | C1527168 | Bonnevie-Ullrich Syndrome | 1 | CTD_human |
Hgene | CAT | C1571983 | Involutional paraphrenia | 1 | CTD_human |
Hgene | CAT | C1571984 | Psychosis, Involutional | 1 | CTD_human |
Hgene | CAT | C1959583 | Myocardial Failure | 1 | CTD_human |
Hgene | CAT | C1961112 | Heart Decompensation | 1 | CTD_human |
Hgene | CAT | C2711227 | Steatohepatitis | 1 | CTD_human |
Hgene | CAT | C2985290 | Fetal Alcohol Spectrum Disorders | 1 | CTD_human |
Hgene | CAT | C3146244 | Alcohol Related Birth Defect | 1 | CTD_human |
Hgene | CAT | C3241937 | Nonalcoholic Steatohepatitis | 1 | CTD_human |
Hgene | CAT | C3661483 | Partial Fetal Alcohol Syndrome | 1 | CTD_human |
Hgene | CAT | C3714618 | Primary Hyperthyroidism | 1 | CTD_human |
Hgene | CAT | C3837958 | Diabetes Mellitus, Ketosis-Prone | 1 | CTD_human |
Hgene | CAT | C4554117 | Diabetes Mellitus, Sudden-Onset | 1 | CTD_human |
Hgene | CAT | C4704874 | Mammary Carcinoma, Human | 1 | CTD_human |
Hgene | CAT | C4721507 | Alveolitis, Fibrosing | 1 | CTD_human |
Hgene | CAT | C4721845 | Marfan Syndrome, Type I | 1 | CTD_human |
Tgene | C0001787 | Osteoporosis, Age-Related | 1 | CTD_human | |
Tgene | C0007137 | Squamous cell carcinoma | 1 | CTD_human | |
Tgene | C0019193 | Hepatitis, Toxic | 1 | CTD_human | |
Tgene | C0023467 | Leukemia, Myelocytic, Acute | 1 | CTD_human | |
Tgene | C0023893 | Liver Cirrhosis, Experimental | 1 | CTD_human | |
Tgene | C0023903 | Liver neoplasms | 1 | CTD_human | |
Tgene | C0024121 | Lung Neoplasms | 1 | CTD_human | |
Tgene | C0024667 | Animal Mammary Neoplasms | 1 | CTD_human | |
Tgene | C0026640 | Mouth Neoplasms | 1 | CTD_human | |
Tgene | C0026998 | Acute Myeloid Leukemia, M1 | 1 | CTD_human | |
Tgene | C0027626 | Neoplasm Invasiveness | 1 | CTD_human | |
Tgene | C0029456 | Osteoporosis | 1 | CTD_human | |
Tgene | C0029459 | Osteoporosis, Senile | 1 | CTD_human | |
Tgene | C0043094 | Weight Gain | 1 | CTD_human | |
Tgene | C0153381 | Malignant neoplasm of mouth | 1 | CTD_human | |
Tgene | C0242379 | Malignant neoplasm of lung | 1 | CTD_human | |
Tgene | C0345904 | Malignant neoplasm of liver | 1 | CTD_human | |
Tgene | C0345967 | Malignant mesothelioma | 1 | CTD_human | |
Tgene | C0751406 | Post-Traumatic Osteoporosis | 1 | CTD_human | |
Tgene | C0860207 | Drug-Induced Liver Disease | 1 | CTD_human | |
Tgene | C1257925 | Mammary Carcinoma, Animal | 1 | CTD_human | |
Tgene | C1262760 | Hepatitis, Drug-Induced | 1 | CTD_human | |
Tgene | C1879321 | Acute Myeloid Leukemia (AML-M2) | 1 | CTD_human | |
Tgene | C3658290 | Drug-Induced Acute Liver Injury | 1 | CTD_human | |
Tgene | C4277682 | Chemical and Drug Induced Liver Injury | 1 | CTD_human | |
Tgene | C4279912 | Chemically-Induced Liver Toxicity | 1 | CTD_human |