![]() |
||||||
|
![]() | Fusion Gene Summary |
![]() | Fusion Gene ORF analysis |
![]() | Fusion Genomic Features |
![]() | Fusion Protein Features |
![]() | Fusion Gene Sequence |
![]() | Fusion Gene PPI analysis |
![]() | Related Drugs |
![]() | Related Diseases |
Fusion gene:CYTH3-DAGLB (FusionGDB2 ID:HG9265TG221955) |
Fusion Gene Summary for CYTH3-DAGLB |
![]() |
Fusion gene information | Fusion gene name: CYTH3-DAGLB | Fusion gene ID: hg9265tg221955 | Hgene | Tgene | Gene symbol | CYTH3 | DAGLB | Gene ID | 9265 | 221955 |
Gene name | cytohesin 3 | diacylglycerol lipase beta | |
Synonyms | ARNO3|GRP1|PSCD3|cytohesin-3 | DAGLBETA|KCCR13L | |
Cytomap | ('CYTH3')('DAGLB') 7p22.1 | 7p22.1 | |
Type of gene | protein-coding | protein-coding | |
Description | cytohesin-3ARF nucleotide-binding site opener 3PH, SEC7 and coiled-coil domain-containing protein 3general receptor of phosphoinositides 1pleckstrin homology, Sec7 and coiled-coil domains 3 | sn1-specific diacylglycerol lipase betaDGL-beta | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | . | Q8NCG7 | |
Ensembl transtripts involved in fusion gene | ENST00000350796, ENST00000396741, ENST00000488964, | ||
Fusion gene scores | * DoF score | 12 X 10 X 8=960 | 4 X 4 X 3=48 |
# samples | 14 | 4 | |
** MAII score | log2(14/960*10)=-2.77760757866355 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/48*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: CYTH3 [Title/Abstract] AND DAGLB [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | CYTH3(6312104)-DAGLB(6452665), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | CYTH3-DAGLB seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CYTH3-DAGLB seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CYTH3-DAGLB seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | DAGLB | GO:0019369 | arachidonic acid metabolic process | 14610053 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | OV | TCGA-13-0768 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
Top |
Fusion Gene ORF analysis for CYTH3-DAGLB |
![]() * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-3UTR | ENST00000350796 | ENST00000421761 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
5CDS-intron | ENST00000350796 | ENST00000479922 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
Frame-shift | ENST00000350796 | ENST00000297056 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
Frame-shift | ENST00000350796 | ENST00000425398 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
Frame-shift | ENST00000350796 | ENST00000436575 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
In-frame | ENST00000350796 | ENST00000428902 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
intron-3CDS | ENST00000396741 | ENST00000297056 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
intron-3CDS | ENST00000396741 | ENST00000425398 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
intron-3CDS | ENST00000396741 | ENST00000428902 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
intron-3CDS | ENST00000396741 | ENST00000436575 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
intron-3CDS | ENST00000488964 | ENST00000297056 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
intron-3CDS | ENST00000488964 | ENST00000425398 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
intron-3CDS | ENST00000488964 | ENST00000428902 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
intron-3CDS | ENST00000488964 | ENST00000436575 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
intron-3UTR | ENST00000396741 | ENST00000421761 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
intron-3UTR | ENST00000488964 | ENST00000421761 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
intron-intron | ENST00000396741 | ENST00000479922 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
intron-intron | ENST00000488964 | ENST00000479922 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000350796 | CYTH3 | chr7 | 6312104 | - | ENST00000428902 | DAGLB | chr7 | 6452665 | - | 596 | 171 | 178 | 594 | 139 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000350796 | ENST00000428902 | CYTH3 | chr7 | 6312104 | - | DAGLB | chr7 | 6452665 | - | 0.15992063 | 0.8400794 |
Top |
Fusion Genomic Features for CYTH3-DAGLB |
![]() |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
![]() |
![]() |
Top |
Fusion Protein Features for CYTH3-DAGLB |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:6312104/chr7:6452665) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | DAGLB |
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. | FUNCTION: Lipase that catalyzes the hydrolysis of arachidonic acid (AA)-esterified diacylglycerols (DAGs) to produce the principal endocannabinoid, 2-arachidonoylglycerol (2-AG) which can be further cleaved by downstream enzymes to release arachidonic acid (AA) for cyclooxygenase (COX)-mediated eicosanoid production (PubMed:14610053). Preferentially hydrolyzes DAGs at the sn-1 position in a calcium-dependent manner and has negligible activity against other lipids including monoacylglycerols and phospholipids (PubMed:14610053). Plays a key role in the regulation of 2-AG and AA pools utilized by COX1/2 to generate lipid mediators of macrophage and microglia inflammatory responses. Functions also as a polyunsaturated fatty acids-specific triacylglycerol lipase in macrophages. Plays an important role to support the metabolic and signaling demands of macrophages (By similarity). {ECO:0000250|UniProtKB:Q91WC9, ECO:0000269|PubMed:14610053}. |
![]() * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CYTH3 | chr7:6312104 | chr7:6452665 | ENST00000350796 | - | 1 | 13 | 14_61 | 11 | 400.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | CYTH3 | chr7:6312104 | chr7:6452665 | ENST00000350796 | - | 1 | 13 | 264_381 | 11 | 400.0 | Domain | PH |
Hgene | CYTH3 | chr7:6312104 | chr7:6452665 | ENST00000350796 | - | 1 | 13 | 77_206 | 11 | 400.0 | Domain | SEC7 |
Hgene | CYTH3 | chr7:6312104 | chr7:6452665 | ENST00000350796 | - | 1 | 13 | 273_281 | 11 | 400.0 | Region | Note=Phosphatidylinositol 3%2C4%2C5-trisphosphate binding |
Hgene | CYTH3 | chr7:6312104 | chr7:6452665 | ENST00000350796 | - | 1 | 13 | 392_400 | 11 | 400.0 | Region | C-terminal autoinhibitory region |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000297056 | 10 | 15 | 124_132 | 475 | 673.0 | Topological domain | Extracellular | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000297056 | 10 | 15 | 154_672 | 475 | 673.0 | Topological domain | Cytoplasmic | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000297056 | 10 | 15 | 1_17 | 475 | 673.0 | Topological domain | Cytoplasmic | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000297056 | 10 | 15 | 39_58 | 475 | 673.0 | Topological domain | Extracellular | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000297056 | 10 | 15 | 80_102 | 475 | 673.0 | Topological domain | Cytoplasmic | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000425398 | 8 | 13 | 124_132 | 346 | 544.0 | Topological domain | Extracellular | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000425398 | 8 | 13 | 154_672 | 346 | 544.0 | Topological domain | Cytoplasmic | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000425398 | 8 | 13 | 1_17 | 346 | 544.0 | Topological domain | Cytoplasmic | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000425398 | 8 | 13 | 39_58 | 346 | 544.0 | Topological domain | Extracellular | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000425398 | 8 | 13 | 80_102 | 346 | 544.0 | Topological domain | Cytoplasmic | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000297056 | 10 | 15 | 103_123 | 475 | 673.0 | Transmembrane | Helical | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000297056 | 10 | 15 | 133_153 | 475 | 673.0 | Transmembrane | Helical | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000297056 | 10 | 15 | 18_38 | 475 | 673.0 | Transmembrane | Helical | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000297056 | 10 | 15 | 59_79 | 475 | 673.0 | Transmembrane | Helical | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000425398 | 8 | 13 | 103_123 | 346 | 544.0 | Transmembrane | Helical | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000425398 | 8 | 13 | 133_153 | 346 | 544.0 | Transmembrane | Helical | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000425398 | 8 | 13 | 18_38 | 346 | 544.0 | Transmembrane | Helical | |
Tgene | DAGLB | chr7:6312104 | chr7:6452665 | ENST00000425398 | 8 | 13 | 59_79 | 346 | 544.0 | Transmembrane | Helical |
Top |
Fusion Gene Sequence for CYTH3-DAGLB |
![]() |
>21156_21156_1_CYTH3-DAGLB_CYTH3_chr7_6312104_ENST00000350796_DAGLB_chr7_6452665_ENST00000428902_length(transcript)=596nt_BP=171nt GGAGGAGGCCCGGCCGCGACCCGGGCCGCGCGCTGAGGAGCCGCCCGGTCGCCTGCGCGCTCCCTCCGGCGGCGTCCCCAGCCCGCGGCC CCTCTGCTGCCGGCCCCCGGCTCGCCGGCTGCGGGAGTGGCCTCAAGATGGATGAAGACGGCGGCGGCGAGGGTGGTGGCGCAAAGCTCT GCAGGAATATTCTCAGAGCTTCATCGTGTCACTCGTCCTGGGGAAGGATGTGATTCCCAGGCTCAGTGTGACCAACTTGGAAGATCTGAA GAGAAGAATCTTGCGAGTGGTCGCGCACTGCAATAAACCCAAGTACAAGATCTTGCTGCACGGTTTGTGGTACGAACTGTTTGGAGGAAA CCCCAACAACTTGCCCACGGAGCTGGACGGGGGCGACCAGGAAGTCCTGACACAGCCTCTTCTGGGGGAGCAGAGCCTACTGACGCGCTG GTCCCCGGCCTACAGCTTCTCCAGCGACTCCCCACTGGACTCTTCTCCCAAGTACCCCCCTCTCTACCCTCCCGGCAGGATCATCCACCT GCAGGAGGAGGGCGCCTCGGGGCGGTTTGGCTGCTGCTCTGCTGCTCACTATAGCG >21156_21156_1_CYTH3-DAGLB_CYTH3_chr7_6312104_ENST00000350796_DAGLB_chr7_6452665_ENST00000428902_length(amino acids)=139AA_BP= MQEYSQSFIVSLVLGKDVIPRLSVTNLEDLKRRILRVVAHCNKPKYKILLHGLWYELFGGNPNNLPTELDGGDQEVLTQPLLGEQSLLTR WSPAYSFSSDSPLDSSPKYPPLYPPGRIIHLQEEGASGRFGCCSAAHYS -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for CYTH3-DAGLB |
![]() |
![]() |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for CYTH3-DAGLB |
![]() (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for CYTH3-DAGLB |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |