| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:FBXW8-CHST11 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: FBXW8-CHST11 | FusionPDB ID: 29931 | FusionGDB2.0 ID: 29931 | Hgene | Tgene | Gene symbol | FBXW8 | CHST11 | Gene ID | 26259 | 50515 |
| Gene name | F-box and WD repeat domain containing 8 | carbohydrate sulfotransferase 11 | |
| Synonyms | FBW6|FBW8|FBX29|FBXO29|FBXW6 | C4ST|C4ST-1|C4ST1|HSA269537|OCBMD | |
| Cytomap | 12q24.22 | 12q23.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | F-box/WD repeat-containing protein 8F-box and WD-40 domain protein 8F-box and WD-40 domain-containing protein 8F-box only protein 29 | carbohydrate sulfotransferase 11C4S-1IgH/CHST11 fusioncarbohydrate (chondroitin 4) sulfotransferase 11chondroitin 4-O-sulfotransferase 1 | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q8N3Y1 | Q9NPF2 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000309909, ENST00000455858, ENST00000551773, | ENST00000550711, ENST00000303694, ENST00000549260, ENST00000546689, ENST00000547956, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 8 X 7 X 5=280 | 14 X 13 X 7=1274 |
| # samples | 8 | 16 | |
| ** MAII score | log2(8/280*10)=-1.8073549220576 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(16/1274*10)=-2.99322146736894 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: FBXW8 [Title/Abstract] AND CHST11 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | FBXW8(117426674)-CHST11(104995684), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | FBXW8-CHST11 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. FBXW8-CHST11 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. FBXW8-CHST11 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. FBXW8-CHST11 seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. FBXW8-CHST11 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. FBXW8-CHST11 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | FBXW8 | GO:0008283 | cell proliferation | 24362026 |
| Hgene | FBXW8 | GO:0016567 | protein ubiquitination | 18498745|24362026 |
| Hgene | FBXW8 | GO:0050775 | positive regulation of dendrite morphogenesis | 21572988 |
| Tgene | CHST11 | GO:0030206 | chondroitin sulfate biosynthetic process | 11056388 |
| Fusion gene breakpoints across FBXW8 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across CHST11 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BRCA | TCGA-B6-A0RH-01A | FBXW8 | chr12 | 117426674 | - | CHST11 | chr12 | 104995684 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000309909 | FBXW8 | chr12 | 117426674 | - | ENST00000547956 | CHST11 | chr12 | 104995684 | + | 1695 | 1321 | 25 | 1410 | 461 |
| ENST00000309909 | FBXW8 | chr12 | 117426674 | - | ENST00000546689 | CHST11 | chr12 | 104995684 | + | 1563 | 1321 | 25 | 1410 | 461 |
| ENST00000455858 | FBXW8 | chr12 | 117426674 | - | ENST00000547956 | CHST11 | chr12 | 104995684 | + | 1488 | 1114 | 16 | 1203 | 395 |
| ENST00000455858 | FBXW8 | chr12 | 117426674 | - | ENST00000546689 | CHST11 | chr12 | 104995684 | + | 1356 | 1114 | 16 | 1203 | 395 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000309909 | ENST00000547956 | FBXW8 | chr12 | 117426674 | - | CHST11 | chr12 | 104995684 | + | 0.001479143 | 0.9985209 |
| ENST00000309909 | ENST00000546689 | FBXW8 | chr12 | 117426674 | - | CHST11 | chr12 | 104995684 | + | 0.001241591 | 0.99875844 |
| ENST00000455858 | ENST00000547956 | FBXW8 | chr12 | 117426674 | - | CHST11 | chr12 | 104995684 | + | 0.002136143 | 0.9978638 |
| ENST00000455858 | ENST00000546689 | FBXW8 | chr12 | 117426674 | - | CHST11 | chr12 | 104995684 | + | 0.00179717 | 0.9982028 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >29931_29931_1_FBXW8-CHST11_FBXW8_chr12_117426674_ENST00000309909_CHST11_chr12_104995684_ENST00000546689_length(amino acids)=461AA_BP=432 MSRGTRWNRGERGAPGAANMDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPEVGSGRGEQASGDPALAQRLLEGAGRPPAARA TRAEGQDVASRSRSPLAREGAGGGEQLVDQLIRDLNEMNDVPFFDIQLPYELAINIFQYLDRKELGRCAQVSKTWKVIAEDEVLWYRLCQ QEGHLPDSSISDYSCWKLIFQECRAKEHMLRTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESED EEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYPVHRFEHDARIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEV PKLVQYLEIVPETRRYPVAVAAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYEGSKSCGGIPLVWTSAAGRGPE -------------------------------------------------------------- >29931_29931_2_FBXW8-CHST11_FBXW8_chr12_117426674_ENST00000309909_CHST11_chr12_104995684_ENST00000547956_length(amino acids)=461AA_BP=432 MSRGTRWNRGERGAPGAANMDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPEVGSGRGEQASGDPALAQRLLEGAGRPPAARA TRAEGQDVASRSRSPLAREGAGGGEQLVDQLIRDLNEMNDVPFFDIQLPYELAINIFQYLDRKELGRCAQVSKTWKVIAEDEVLWYRLCQ QEGHLPDSSISDYSCWKLIFQECRAKEHMLRTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESED EEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYPVHRFEHDARIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEV PKLVQYLEIVPETRRYPVAVAAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYEGSKSCGGIPLVWTSAAGRGPE -------------------------------------------------------------- >29931_29931_3_FBXW8-CHST11_FBXW8_chr12_117426674_ENST00000455858_CHST11_chr12_104995684_ENST00000546689_length(amino acids)=395AA_BP=366 MSRGTRWNRGERGAPGAANMDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPENEMNDVPFFDIQLPYELAINIFQYLDRKELG RCAQVSKTWKVIAEDEVLWYRLCQQEGHLPDSSISDYSCWKLIFQECRAKEHMLRTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGY TSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYPVHRFEHDARIQALALSQDDATVATA SAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVAVAAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGW -------------------------------------------------------------- >29931_29931_4_FBXW8-CHST11_FBXW8_chr12_117426674_ENST00000455858_CHST11_chr12_104995684_ENST00000547956_length(amino acids)=395AA_BP=366 MSRGTRWNRGERGAPGAANMDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPENEMNDVPFFDIQLPYELAINIFQYLDRKELG RCAQVSKTWKVIAEDEVLWYRLCQQEGHLPDSSISDYSCWKLIFQECRAKEHMLRTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGY TSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYPVHRFEHDARIQALALSQDDATVATA SAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVAVAAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGW -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr12:117426674/chr12:104995684) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| FBXW8 | CHST11 |
| FUNCTION: Substrate-recognition component of a Cul7-RING ubiquitin-protein ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. The Cul7-RING(FBXW8) complex mediates ubiquitination and consequent degradation of GORASP1, acting as a component of the ubiquitin ligase pathway that regulates Golgi morphogenesis and dendrite patterning in brain (PubMed:21572988). Mediates ubiquitination and degradation of IRS1 in a mTOR-dependent manner: the Cul7-RING(FBXW8) complex recognizes and binds IRS1 previously phosphorylated by S6 kinase (RPS6KB1 or RPS6KB2) (PubMed:18498745). The Cul7-RING(FBXW8) complex also mediates ubiquitination of MAP4K1/HPK1: recognizes and binds autophosphorylated MAP4K1/HPK1, leading to its degradation, thereby affecting cell proliferation and differentiation (PubMed:24362026). Associated component of the 3M complex, suggesting that it mediates some of 3M complex functions (PubMed:24793695). {ECO:0000269|PubMed:18498745, ECO:0000269|PubMed:21572988, ECO:0000269|PubMed:24362026, ECO:0000269|PubMed:24793695}. | FUNCTION: Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Can also sulfate Gal residues in desulfated dermatan sulfate. Preferentially sulfates in GlcA->GalNAc unit than in IdoA->GalNAc unit. Does not form 4, 6-di-O-sulfated GalNAc when chondroitin sulfate C is used as an acceptor. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | FBXW8 | chr12:117426674 | chr12:104995684 | ENST00000309909 | - | 7 | 11 | 113_159 | 413.0 | 599.0 | Domain | F-box |
| Hgene | FBXW8 | chr12:117426674 | chr12:104995684 | ENST00000455858 | - | 7 | 11 | 113_159 | 347.0 | 533.0 | Domain | F-box |
| Hgene | FBXW8 | chr12:117426674 | chr12:104995684 | ENST00000309909 | - | 7 | 11 | 197_245 | 413.0 | 599.0 | Repeat | Note=WD 1 |
| Hgene | FBXW8 | chr12:117426674 | chr12:104995684 | ENST00000309909 | - | 7 | 11 | 254_294 | 413.0 | 599.0 | Repeat | Note=WD 2 |
| Hgene | FBXW8 | chr12:117426674 | chr12:104995684 | ENST00000309909 | - | 7 | 11 | 297_336 | 413.0 | 599.0 | Repeat | Note=WD 3 |
| Hgene | FBXW8 | chr12:117426674 | chr12:104995684 | ENST00000455858 | - | 7 | 11 | 197_245 | 347.0 | 533.0 | Repeat | Note=WD 1 |
| Hgene | FBXW8 | chr12:117426674 | chr12:104995684 | ENST00000455858 | - | 7 | 11 | 254_294 | 347.0 | 533.0 | Repeat | Note=WD 2 |
| Hgene | FBXW8 | chr12:117426674 | chr12:104995684 | ENST00000455858 | - | 7 | 11 | 297_336 | 347.0 | 533.0 | Repeat | Note=WD 3 |
| Tgene | CHST11 | chr12:117426674 | chr12:104995684 | ENST00000303694 | 0 | 3 | 124_130 | 39.333333333333336 | 353.0 | Nucleotide binding | PAPS | |
| Tgene | CHST11 | chr12:117426674 | chr12:104995684 | ENST00000303694 | 0 | 3 | 186_194 | 39.333333333333336 | 353.0 | Nucleotide binding | PAPS | |
| Tgene | CHST11 | chr12:117426674 | chr12:104995684 | ENST00000549260 | 0 | 3 | 124_130 | 34.333333333333336 | 348.0 | Nucleotide binding | PAPS | |
| Tgene | CHST11 | chr12:117426674 | chr12:104995684 | ENST00000549260 | 0 | 3 | 186_194 | 34.333333333333336 | 348.0 | Nucleotide binding | PAPS | |
| Tgene | CHST11 | chr12:117426674 | chr12:104995684 | ENST00000303694 | 0 | 3 | 38_352 | 39.333333333333336 | 353.0 | Topological domain | Lumenal | |
| Tgene | CHST11 | chr12:117426674 | chr12:104995684 | ENST00000549260 | 0 | 3 | 38_352 | 34.333333333333336 | 348.0 | Topological domain | Lumenal |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | FBXW8 | chr12:117426674 | chr12:104995684 | ENST00000309909 | - | 7 | 11 | 430_470 | 413.0 | 599.0 | Repeat | Note=WD 4 |
| Hgene | FBXW8 | chr12:117426674 | chr12:104995684 | ENST00000309909 | - | 7 | 11 | 473_510 | 413.0 | 599.0 | Repeat | Note=WD 5 |
| Hgene | FBXW8 | chr12:117426674 | chr12:104995684 | ENST00000455858 | - | 7 | 11 | 430_470 | 347.0 | 533.0 | Repeat | Note=WD 4 |
| Hgene | FBXW8 | chr12:117426674 | chr12:104995684 | ENST00000455858 | - | 7 | 11 | 473_510 | 347.0 | 533.0 | Repeat | Note=WD 5 |
| Tgene | CHST11 | chr12:117426674 | chr12:104995684 | ENST00000303694 | 0 | 3 | 1_16 | 39.333333333333336 | 353.0 | Topological domain | Cytoplasmic | |
| Tgene | CHST11 | chr12:117426674 | chr12:104995684 | ENST00000549260 | 0 | 3 | 1_16 | 34.333333333333336 | 348.0 | Topological domain | Cytoplasmic | |
| Tgene | CHST11 | chr12:117426674 | chr12:104995684 | ENST00000303694 | 0 | 3 | 17_37 | 39.333333333333336 | 353.0 | Transmembrane | Helical%3B Signal-anchor for type II membrane protein | |
| Tgene | CHST11 | chr12:117426674 | chr12:104995684 | ENST00000549260 | 0 | 3 | 17_37 | 34.333333333333336 | 348.0 | Transmembrane | Helical%3B Signal-anchor for type II membrane protein |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| FBXW8 | |
| CHST11 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to FBXW8-CHST11 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to FBXW8-CHST11 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies