| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:NF2-EIF3D |
Fusion Protein Summary |
Fusion gene summary |
| Fusion partner gene information | Fusion gene name: NF2-EIF3D | FusionPDB ID: 58722 | FusionGDB2.0 ID: 58722 | Hgene | Tgene | Gene symbol | NF2 | EIF3D | Gene ID | 4771 | 8664 |
| Gene name | neurofibromin 2 | eukaryotic translation initiation factor 3 subunit D | |
| Synonyms | ACN|BANF|SCH | EIF3S7|eIF3-p66|eIF3-zeta | |
| Cytomap | 22q12.2 | 22q12.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | merlinmoesin-ezrin-radixin likemoesin-ezrin-radixin-like proteinmoesin-ezrin-radizin-like proteinneurofibromin 2 (bilateral acoustic neuroma)schwannomerlinschwannomin | eukaryotic translation initiation factor 3 subunit DeIF3 p66eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDatranslation initiation factor eIF3 p66 subunit | |
| Modification date | 20200322 | 20200313 | |
| UniProtAcc | P35240 | O15371 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000334961, ENST00000338641, ENST00000347330, ENST00000353887, ENST00000361166, ENST00000361452, ENST00000361676, ENST00000397789, ENST00000403435, ENST00000403999, ENST00000413209, | ENST00000405442, ENST00000478547, ENST00000541106, ENST00000216190, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 15 X 11 X 7=1155 | 14 X 13 X 8=1456 |
| # samples | 18 | 18 | |
| ** MAII score | log2(18/1155*10)=-2.68182403997375 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(18/1456*10)=-3.01594154386902 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: NF2 [Title/Abstract] AND EIF3D [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | NF2(30000101)-EIF3D(36908649), # samples:3 | ||
| Anticipated loss of major functional domain due to fusion event. | NF2-EIF3D seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NF2-EIF3D seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NF2-EIF3D seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. NF2-EIF3D seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | NF2 | GO:0008285 | negative regulation of cell proliferation | 12444102|20178741 |
| Hgene | NF2 | GO:0022408 | negative regulation of cell-cell adhesion | 17210637 |
| Hgene | NF2 | GO:0042532 | negative regulation of tyrosine phosphorylation of STAT protein | 12444102 |
| Hgene | NF2 | GO:0046426 | negative regulation of JAK-STAT cascade | 12444102 |
| Tgene | EIF3D | GO:0002191 | cap-dependent translational initiation | 27462815 |
| Tgene | EIF3D | GO:0006413 | translational initiation | 17581632 |
| Tgene | EIF3D | GO:0075522 | IRES-dependent viral translational initiation | 9573242 |
| Tgene | EIF3D | GO:0075525 | viral translational termination-reinitiation | 21347434 |
Fusion gene breakpoints across NF2 (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Fusion gene breakpoints across EIF3D (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BRCA | TCGA-V7-A7HQ-01A | NF2 | chr22 | 30000101 | - | EIF3D | chr22 | 36908649 | - |
| ChimerDB4 | BRCA | TCGA-V7-A7HQ-01A | NF2 | chr22 | 30000101 | + | EIF3D | chr22 | 36908649 | - |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000347330 | NF2 | chr22 | 30000101 | + | ENST00000216190 | EIF3D | chr22 | 36908649 | - | 1135 | 557 | 362 | 997 | 211 |
| ENST00000413209 | NF2 | chr22 | 30000101 | + | ENST00000216190 | EIF3D | chr22 | 36908649 | - | 1135 | 557 | 362 | 997 | 211 |
| ENST00000338641 | NF2 | chr22 | 30000101 | + | ENST00000216190 | EIF3D | chr22 | 36908649 | - | 1133 | 555 | 360 | 995 | 211 |
| ENST00000403435 | NF2 | chr22 | 30000101 | + | ENST00000216190 | EIF3D | chr22 | 36908649 | - | 1103 | 525 | 330 | 965 | 211 |
| ENST00000361452 | NF2 | chr22 | 30000101 | + | ENST00000216190 | EIF3D | chr22 | 36908649 | - | 1074 | 496 | 301 | 936 | 211 |
| ENST00000403999 | NF2 | chr22 | 30000101 | + | ENST00000216190 | EIF3D | chr22 | 36908649 | - | 1058 | 480 | 285 | 920 | 211 |
| ENST00000334961 | NF2 | chr22 | 30000101 | + | ENST00000216190 | EIF3D | chr22 | 36908649 | - | 964 | 386 | 191 | 826 | 211 |
| ENST00000353887 | NF2 | chr22 | 30000101 | + | ENST00000216190 | EIF3D | chr22 | 36908649 | - | 944 | 366 | 171 | 806 | 211 |
| ENST00000361166 | NF2 | chr22 | 30000101 | + | ENST00000216190 | EIF3D | chr22 | 36908649 | - | 692 | 114 | 0 | 554 | 184 |
| ENST00000397789 | NF2 | chr22 | 30000101 | + | ENST00000216190 | EIF3D | chr22 | 36908649 | - | 692 | 114 | 0 | 554 | 184 |
| ENST00000361676 | NF2 | chr22 | 30000101 | + | ENST00000216190 | EIF3D | chr22 | 36908649 | - | 692 | 114 | 0 | 554 | 184 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000347330 | ENST00000216190 | NF2 | chr22 | 30000101 | + | EIF3D | chr22 | 36908649 | - | 0.005323888 | 0.9946761 |
| ENST00000413209 | ENST00000216190 | NF2 | chr22 | 30000101 | + | EIF3D | chr22 | 36908649 | - | 0.005323888 | 0.9946761 |
| ENST00000338641 | ENST00000216190 | NF2 | chr22 | 30000101 | + | EIF3D | chr22 | 36908649 | - | 0.005423156 | 0.9945768 |
| ENST00000403435 | ENST00000216190 | NF2 | chr22 | 30000101 | + | EIF3D | chr22 | 36908649 | - | 0.004869058 | 0.995131 |
| ENST00000361452 | ENST00000216190 | NF2 | chr22 | 30000101 | + | EIF3D | chr22 | 36908649 | - | 0.003848303 | 0.9961516 |
| ENST00000403999 | ENST00000216190 | NF2 | chr22 | 30000101 | + | EIF3D | chr22 | 36908649 | - | 0.004327975 | 0.9956721 |
| ENST00000334961 | ENST00000216190 | NF2 | chr22 | 30000101 | + | EIF3D | chr22 | 36908649 | - | 0.005432279 | 0.99456775 |
| ENST00000353887 | ENST00000216190 | NF2 | chr22 | 30000101 | + | EIF3D | chr22 | 36908649 | - | 0.004933714 | 0.9950663 |
| ENST00000361166 | ENST00000216190 | NF2 | chr22 | 30000101 | + | EIF3D | chr22 | 36908649 | - | 0.003528084 | 0.996472 |
| ENST00000397789 | ENST00000216190 | NF2 | chr22 | 30000101 | + | EIF3D | chr22 | 36908649 | - | 0.003528084 | 0.996472 |
| ENST00000361676 | ENST00000216190 | NF2 | chr22 | 30000101 | + | EIF3D | chr22 | 36908649 | - | 0.003528084 | 0.996472 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >58722_58722_1_NF2-EIF3D_NF2_chr22_30000101_ENST00000334961_EIF3D_chr22_36908649_ENST00000216190_length(amino acids)=211AA_BP=65 MCSNSRGAKGLRVQAVGREGPGPEPRAMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEHCNGVDWRQKLDSQRGAVIATELKN NSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVI -------------------------------------------------------------- >58722_58722_2_NF2-EIF3D_NF2_chr22_30000101_ENST00000338641_EIF3D_chr22_36908649_ENST00000216190_length(amino acids)=211AA_BP=65 MCSNSRGAKGLRVQAVGREGPGPEPRAMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEHCNGVDWRQKLDSQRGAVIATELKN NSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVI -------------------------------------------------------------- >58722_58722_3_NF2-EIF3D_NF2_chr22_30000101_ENST00000347330_EIF3D_chr22_36908649_ENST00000216190_length(amino acids)=211AA_BP=65 MCSNSRGAKGLRVQAVGREGPGPEPRAMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEHCNGVDWRQKLDSQRGAVIATELKN NSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVI -------------------------------------------------------------- >58722_58722_4_NF2-EIF3D_NF2_chr22_30000101_ENST00000353887_EIF3D_chr22_36908649_ENST00000216190_length(amino acids)=211AA_BP=65 MCSNSRGAKGLRVQAVGREGPGPEPRAMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEHCNGVDWRQKLDSQRGAVIATELKN NSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVI -------------------------------------------------------------- >58722_58722_5_NF2-EIF3D_NF2_chr22_30000101_ENST00000361166_EIF3D_chr22_36908649_ENST00000216190_length(amino acids)=184AA_BP=38 MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSR YHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEEEEEE -------------------------------------------------------------- >58722_58722_6_NF2-EIF3D_NF2_chr22_30000101_ENST00000361452_EIF3D_chr22_36908649_ENST00000216190_length(amino acids)=211AA_BP=65 MCSNSRGAKGLRVQAVGREGPGPEPRAMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEHCNGVDWRQKLDSQRGAVIATELKN NSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVI -------------------------------------------------------------- >58722_58722_7_NF2-EIF3D_NF2_chr22_30000101_ENST00000361676_EIF3D_chr22_36908649_ENST00000216190_length(amino acids)=184AA_BP=38 MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSR YHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEEEEEE -------------------------------------------------------------- >58722_58722_8_NF2-EIF3D_NF2_chr22_30000101_ENST00000397789_EIF3D_chr22_36908649_ENST00000216190_length(amino acids)=184AA_BP=38 MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSR YHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEEEEEE -------------------------------------------------------------- >58722_58722_9_NF2-EIF3D_NF2_chr22_30000101_ENST00000403435_EIF3D_chr22_36908649_ENST00000216190_length(amino acids)=211AA_BP=65 MCSNSRGAKGLRVQAVGREGPGPEPRAMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEHCNGVDWRQKLDSQRGAVIATELKN NSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVI -------------------------------------------------------------- >58722_58722_10_NF2-EIF3D_NF2_chr22_30000101_ENST00000403999_EIF3D_chr22_36908649_ENST00000216190_length(amino acids)=211AA_BP=65 MCSNSRGAKGLRVQAVGREGPGPEPRAMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEHCNGVDWRQKLDSQRGAVIATELKN NSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVI -------------------------------------------------------------- >58722_58722_11_NF2-EIF3D_NF2_chr22_30000101_ENST00000413209_EIF3D_chr22_36908649_ENST00000216190_length(amino acids)=211AA_BP=65 MCSNSRGAKGLRVQAVGREGPGPEPRAMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEHCNGVDWRQKLDSQRGAVIATELKN NSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVI -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genesGo to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr22:30000101/chr22:36908649) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| NF2 | EIF3D |
| FUNCTION: Probable regulator of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in tumor suppression by restricting proliferation and promoting apoptosis. Along with WWC1 can synergistically induce the phosphorylation of LATS1 and LATS2 and can probably function in the regulation of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway. May act as a membrane stabilizing protein. May inhibit PI3 kinase by binding to AGAP2 and impairing its stimulating activity. Suppresses cell proliferation and tumorigenesis by inhibiting the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex. {ECO:0000269|PubMed:20159598, ECO:0000269|PubMed:20178741, ECO:0000269|PubMed:21167305}. | FUNCTION: mRNA cap-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, a complex required for several steps in the initiation of protein synthesis of a specialized repertoire of mRNAs (PubMed:27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed:18599441, PubMed:25849773). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed:25849773). In the eIF-3 complex, EIF3D specifically recognizes and binds the 7-methylguanosine cap of a subset of mRNAs (PubMed:27462815). {ECO:0000269|PubMed:18599441, ECO:0000269|PubMed:25849773, ECO:0000269|PubMed:27462815}.; FUNCTION: (Microbial infection) In case of FCV infection, plays a role in the ribosomal termination-reinitiation event leading to the translation of VP2 (PubMed:18056426). {ECO:0000269|PubMed:18056426}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | EIF3D | chr22:30000101 | chr22:36908649 | ENST00000216190 | 11 | 15 | 530_547 | 402.0 | 549.0 | Compositional bias | Note=Asp/Glu-rich (highly acidic) | |
| Tgene | EIF3D | chr22:30000101 | chr22:36908649 | ENST00000405442 | 11 | 15 | 530_547 | 402.0 | 549.0 | Compositional bias | Note=Asp/Glu-rich (highly acidic) |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000334961 | + | 1 | 15 | 327_465 | 38.0 | 451.0 | Compositional bias | Note=Glu-rich |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000338641 | + | 1 | 16 | 327_465 | 38.0 | 596.0 | Compositional bias | Note=Glu-rich |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000347330 | + | 1 | 10 | 327_465 | 38.0 | 1312.6666666666667 | Compositional bias | Note=Glu-rich |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000353887 | + | 1 | 15 | 327_465 | 38.0 | 406.0 | Compositional bias | Note=Glu-rich |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000361166 | + | 1 | 17 | 327_465 | 38.0 | 571.3333333333334 | Compositional bias | Note=Glu-rich |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000361452 | + | 1 | 16 | 327_465 | 38.0 | 1665.6666666666667 | Compositional bias | Note=Glu-rich |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000361676 | + | 1 | 16 | 327_465 | 38.0 | 531.0 | Compositional bias | Note=Glu-rich |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000397789 | + | 1 | 17 | 327_465 | 38.0 | 573.0 | Compositional bias | Note=Glu-rich |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000403435 | + | 1 | 17 | 327_465 | 38.0 | 541.0 | Compositional bias | Note=Glu-rich |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000403999 | + | 1 | 16 | 327_465 | 38.0 | 591.0 | Compositional bias | Note=Glu-rich |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000413209 | + | 1 | 5 | 327_465 | 38.0 | 166.0 | Compositional bias | Note=Glu-rich |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000334961 | + | 1 | 15 | 22_311 | 38.0 | 451.0 | Domain | FERM |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000338641 | + | 1 | 16 | 22_311 | 38.0 | 596.0 | Domain | FERM |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000347330 | + | 1 | 10 | 22_311 | 38.0 | 1312.6666666666667 | Domain | FERM |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000353887 | + | 1 | 15 | 22_311 | 38.0 | 406.0 | Domain | FERM |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000361166 | + | 1 | 17 | 22_311 | 38.0 | 571.3333333333334 | Domain | FERM |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000361452 | + | 1 | 16 | 22_311 | 38.0 | 1665.6666666666667 | Domain | FERM |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000361676 | + | 1 | 16 | 22_311 | 38.0 | 531.0 | Domain | FERM |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000397789 | + | 1 | 17 | 22_311 | 38.0 | 573.0 | Domain | FERM |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000403435 | + | 1 | 17 | 22_311 | 38.0 | 541.0 | Domain | FERM |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000403999 | + | 1 | 16 | 22_311 | 38.0 | 591.0 | Domain | FERM |
| Hgene | NF2 | chr22:30000101 | chr22:36908649 | ENST00000413209 | + | 1 | 5 | 22_311 | 38.0 | 166.0 | Domain | FERM |
| Tgene | EIF3D | chr22:30000101 | chr22:36908649 | ENST00000216190 | 11 | 15 | 285_299 | 402.0 | 549.0 | Region | RNA gate | |
| Tgene | EIF3D | chr22:30000101 | chr22:36908649 | ENST00000405442 | 11 | 15 | 285_299 | 402.0 | 549.0 | Region | RNA gate |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| NF2 | |
| EIF3D |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to NF2-EIF3D |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to NF2-EIF3D |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |