UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:ZNF480-ELL |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: ZNF480-ELL | FusionPDB ID: 102184 | FusionGDB2.0 ID: 102184 | Hgene | Tgene | Gene symbol | ZNF480 | ELL | Gene ID | 147657 | 8178 |
Gene name | zinc finger protein 480 | elongation factor for RNA polymerase II | |
Synonyms | - | C19orf17|ELL1|MEN|PPP1R68 | |
Cytomap | 19q13.41 | 19p13.11 | |
Type of gene | protein-coding | protein-coding | |
Description | zinc finger protein 480 | RNA polymerase II elongation factor ELLELL gene (11-19 lysine-rich leukemia gene)ELL/KMT2A fusionELL/KMT2A fusion proteinKMT2A/ELL fusionKMT2A/ELL fusion proteineleven-nineteen lysine-rich leukemia proteinelongation factor RNA polymerase IIprotein | |
Modification date | 20200313 | 20200319 | |
UniProtAcc | . | O00472 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000335090, ENST00000595962, ENST00000334564, ENST00000490272, | ENST00000262809, ENST00000596124, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 4 X 2 X 4=32 | 11 X 17 X 7=1309 |
# samples | 4 | 21 | |
** MAII score | log2(4/32*10)=0.321928094887362 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(21/1309*10)=-2.64000386427912 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: ZNF480 [Title/Abstract] AND ELL [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ZNF480(52819215)-ELL(18572662), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | ZNF480-ELL seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ZNF480-ELL seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ZNF480-ELL seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ZNF480-ELL seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | ELL | GO:0010923 | negative regulation of phosphatase activity | 19389623 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-HF-7134 | ZNF480 | chr19 | 52819215 | + | ELL | chr19 | 18572662 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000595962 | ZNF480 | chr19 | 52819215 | + | ENST00000262809 | ELL | chr19 | 18572662 | - | 3880 | 394 | 66 | 1790 | 574 |
ENST00000595962 | ZNF480 | chr19 | 52819215 | + | ENST00000596124 | ELL | chr19 | 18572662 | - | 1792 | 394 | 66 | 1790 | 574 |
ENST00000335090 | ZNF480 | chr19 | 52819215 | + | ENST00000262809 | ELL | chr19 | 18572662 | - | 3706 | 220 | 108 | 1616 | 502 |
ENST00000335090 | ZNF480 | chr19 | 52819215 | + | ENST00000596124 | ELL | chr19 | 18572662 | - | 1618 | 220 | 108 | 1616 | 502 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000595962 | ENST00000262809 | ZNF480 | chr19 | 52819215 | + | ELL | chr19 | 18572662 | - | 0.012542358 | 0.9874577 |
ENST00000595962 | ENST00000596124 | ZNF480 | chr19 | 52819215 | + | ELL | chr19 | 18572662 | - | 0.059413243 | 0.94058675 |
ENST00000335090 | ENST00000262809 | ZNF480 | chr19 | 52819215 | + | ELL | chr19 | 18572662 | - | 0.015285355 | 0.9847147 |
ENST00000335090 | ENST00000596124 | ZNF480 | chr19 | 52819215 | + | ELL | chr19 | 18572662 | - | 0.069568254 | 0.9304317 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >102184_102184_1_ZNF480-ELL_ZNF480_chr19_52819215_ENST00000335090_ELL_chr19_18572662_ENST00000262809_length(amino acids)=502AA_BP=37 MNINSMLEQRREPWSGESEVKIAKNSDGRECIKGVNTGKKVQFRKPAPGATDAVPSRKRATPINLASAIRKSGASAVSGGSGVSQRPFRD RVLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTG SLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLGVPNGREALLPTPGPPASTDTLSSSTHLPPRLE PPRAHDPLADVSNDLGHSGRDCEHGEAAAPAPTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHA TPGAPADTPGLNGTCSVSSVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLHARIERITRRFTQLDAQLRQLSQGSEEYET -------------------------------------------------------------- >102184_102184_2_ZNF480-ELL_ZNF480_chr19_52819215_ENST00000335090_ELL_chr19_18572662_ENST00000596124_length(amino acids)=502AA_BP=37 MNINSMLEQRREPWSGESEVKIAKNSDGRECIKGVNTGKKVQFRKPAPGATDAVPSRKRATPINLASAIRKSGASAVSGGSGVSQRPFRD RVLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTG SLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLGVPNGREALLPTPGPPASTDTLSSSTHLPPRLE PPRAHDPLADVSNDLGHSGRDCEHGEAAAPAPTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHA TPGAPADTPGLNGTCSVSSVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLHARIERITRRFTQLDAQLRQLSQGSEEYET -------------------------------------------------------------- >102184_102184_3_ZNF480-ELL_ZNF480_chr19_52819215_ENST00000595962_ELL_chr19_18572662_ENST00000262809_length(amino acids)=574AA_BP=109 MLCDEKAQKRRKRKAKESGMALPQGHLTFRDVAIEFSQAEWKCLDPAQRALYKDVMLENYRNLVSLGISLPDLNINSMLEQRREPWSGES EVKIAKNSDGRECIKGVNTGKKVQFRKPAPGATDAVPSRKRATPINLASAIRKSGASAVSGGSGVSQRPFRDRVLHLLALRPYRKAELLL RLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRS ASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLGVPNGREALLPTPGPPASTDTLSSSTHLPPRLEPPRAHDPLADVSNDLGHS GRDCEHGEAAAPAPTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHATPGAPADTPGLNGTCSVS SVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLHARIERITRRFTQLDAQLRQLSQGSEEYETTRGQILQEYRKIKKTNTN -------------------------------------------------------------- >102184_102184_4_ZNF480-ELL_ZNF480_chr19_52819215_ENST00000595962_ELL_chr19_18572662_ENST00000596124_length(amino acids)=574AA_BP=109 MLCDEKAQKRRKRKAKESGMALPQGHLTFRDVAIEFSQAEWKCLDPAQRALYKDVMLENYRNLVSLGISLPDLNINSMLEQRREPWSGES EVKIAKNSDGRECIKGVNTGKKVQFRKPAPGATDAVPSRKRATPINLASAIRKSGASAVSGGSGVSQRPFRDRVLHLLALRPYRKAELLL RLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRS ASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLGVPNGREALLPTPGPPASTDTLSSSTHLPPRLEPPRAHDPLADVSNDLGHS GRDCEHGEAAAPAPTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHATPGAPADTPGLNGTCSVS SVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLHARIERITRRFTQLDAQLRQLSQGSEEYETTRGQILQEYRKIKKTNTN -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:52819215/chr19:18572662) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | ELL |
FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Elongation factor component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Component of the little elongation complex (LEC), a complex required to regulate small nuclear RNA (snRNA) gene transcription by RNA polymerase II and III (PubMed:22195968). Plays a role in immunoglobulin secretion in plasma cells: directs efficient alternative mRNA processing, influencing both proximal poly(A) site choice and exon skipping, as well as immunoglobulin heavy chain (IgH) alternative processing. Probably acts by regulating histone modifications accompanying transition from membrane-specific to secretory IgH mRNA expression. {ECO:0000269|PubMed:20159561, ECO:0000269|PubMed:20471948, ECO:0000269|PubMed:22195968, ECO:0000269|PubMed:23251033}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 27_98 | 109.33333333333333 | 536.0 | Domain | KRAB |
Tgene | ELL | chr19:52819215 | chr19:18572662 | ENST00000262809 | 3 | 12 | 445_459 | 156.33333333333334 | 622.0 | Motif | Nuclear localization signal |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 27_98 | 32.333333333333336 | 459.0 | Domain | KRAB |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 203_225 | 32.333333333333336 | 459.0 | Zinc finger | C2H2-type 1%3B atypical |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 231_253 | 32.333333333333336 | 459.0 | Zinc finger | C2H2-type 2 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 259_281 | 32.333333333333336 | 459.0 | Zinc finger | C2H2-type 3 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 287_309 | 32.333333333333336 | 459.0 | Zinc finger | C2H2-type 4 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 315_337 | 32.333333333333336 | 459.0 | Zinc finger | C2H2-type 5%3B degenerate |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 343_365 | 32.333333333333336 | 459.0 | Zinc finger | C2H2-type 6 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 371_393 | 32.333333333333336 | 459.0 | Zinc finger | C2H2-type 7 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 399_421 | 32.333333333333336 | 459.0 | Zinc finger | C2H2-type 8 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 427_449 | 32.333333333333336 | 459.0 | Zinc finger | C2H2-type 9 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 455_477 | 32.333333333333336 | 459.0 | Zinc finger | C2H2-type 10 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 483_505 | 32.333333333333336 | 459.0 | Zinc finger | C2H2-type 11 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000335090 | + | 2 | 3 | 511_533 | 32.333333333333336 | 459.0 | Zinc finger | C2H2-type 12 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 203_225 | 109.33333333333333 | 536.0 | Zinc finger | C2H2-type 1%3B atypical |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 231_253 | 109.33333333333333 | 536.0 | Zinc finger | C2H2-type 2 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 259_281 | 109.33333333333333 | 536.0 | Zinc finger | C2H2-type 3 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 287_309 | 109.33333333333333 | 536.0 | Zinc finger | C2H2-type 4 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 315_337 | 109.33333333333333 | 536.0 | Zinc finger | C2H2-type 5%3B degenerate |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 343_365 | 109.33333333333333 | 536.0 | Zinc finger | C2H2-type 6 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 371_393 | 109.33333333333333 | 536.0 | Zinc finger | C2H2-type 7 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 399_421 | 109.33333333333333 | 536.0 | Zinc finger | C2H2-type 8 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 427_449 | 109.33333333333333 | 536.0 | Zinc finger | C2H2-type 9 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 455_477 | 109.33333333333333 | 536.0 | Zinc finger | C2H2-type 10 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 483_505 | 109.33333333333333 | 536.0 | Zinc finger | C2H2-type 11 |
Hgene | ZNF480 | chr19:52819215 | chr19:18572662 | ENST00000595962 | + | 4 | 5 | 511_533 | 109.33333333333333 | 536.0 | Zinc finger | C2H2-type 12 |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
ZNF480 | |
ELL | ![]() |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to ZNF480-ELL |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ZNF480-ELL |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |