UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:DCTN3-LINGO2 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: DCTN3-LINGO2 | FusionPDB ID: 21692 | FusionGDB2.0 ID: 21692 | Hgene | Tgene | Gene symbol | DCTN3 | LINGO2 | Gene ID | 11258 | 158038 |
Gene name | dynactin subunit 3 | leucine rich repeat and Ig domain containing 2 | |
Synonyms | DCTN-22|DCTN22 | LERN3|LRRN6C | |
Cytomap | 9p13.3 | 9p21.2-p21.1 | |
Type of gene | protein-coding | protein-coding | |
Description | dynactin subunit 3dynactin 3 (p22)dynactin complex subunit 22 kDa subunitdynactin light chain | leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2leucine rich repeat neuronal 6Cleucine-rich repeat neuronal protein 3leucine-rich repeat neuronal protein 6C | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | O75935 | Q7L985 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000259632, ENST00000341694, ENST00000378913, ENST00000378916, ENST00000447983, ENST00000477738, ENST00000479399, | ENST00000308675, ENST00000493941, ENST00000379992, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 4 X 4 X 3=48 | 11 X 8 X 8=704 |
# samples | 4 | 13 | |
** MAII score | log2(4/48*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(13/704*10)=-2.43706380560884 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: DCTN3 [Title/Abstract] AND LINGO2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | DCTN3(34618673)-LINGO2(28670278), # samples:2 LINGO2(28295206)-DCTN3(34618757), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | DCTN3-LINGO2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. DCTN3-LINGO2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. DCTN3-LINGO2 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | DCTN3 | GO:0061640 | cytoskeleton-dependent cytokinesis | 9722614 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LUSC | TCGA-63-A5MM-01A | DCTN3 | chr9 | 34618673 | - | LINGO2 | chr9 | 28670278 | - |
ChimerDB4 | LUSC | TCGA-63-A5MM | DCTN3 | chr9 | 34618673 | - | LINGO2 | chr9 | 28670278 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000341694 | DCTN3 | chr9 | 34618673 | - | ENST00000379992 | LINGO2 | chr9 | 28670278 | - | 3235 | 191 | 641 | 2461 | 606 |
ENST00000447983 | DCTN3 | chr9 | 34618673 | - | ENST00000379992 | LINGO2 | chr9 | 28670278 | - | 3279 | 235 | 685 | 2505 | 606 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000341694 | ENST00000379992 | DCTN3 | chr9 | 34618673 | - | LINGO2 | chr9 | 28670278 | - | 0.00146559 | 0.99853444 |
ENST00000447983 | ENST00000379992 | DCTN3 | chr9 | 34618673 | - | LINGO2 | chr9 | 28670278 | - | 0.001463925 | 0.9985361 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >21692_21692_1_DCTN3-LINGO2_DCTN3_chr9_34618673_ENST00000341694_LINGO2_chr9_28670278_ENST00000379992_length(amino acids)=606AA_BP= MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSVNPEEFISYPLLEEIDLSD NIIANVEPGAFNNLFNLRSLRLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLE QLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSVTNTNLSTVPFLAFK HLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACD CRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHLLVDEGQTVQLECSADGDPQPVISWVTPRRR FITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKT -------------------------------------------------------------- >21692_21692_2_DCTN3-LINGO2_DCTN3_chr9_34618673_ENST00000447983_LINGO2_chr9_28670278_ENST00000379992_length(amino acids)=606AA_BP= MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSVNPEEFISYPLLEEIDLSD NIIANVEPGAFNNLFNLRSLRLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLE QLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSVTNTNLSTVPFLAFK HLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACD CRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHLLVDEGQTVQLECSADGDPQPVISWVTPRRR FITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKT -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:34618673/chr9:28670278) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
DCTN3 | LINGO2 |
FUNCTION: Together with dynein may be involved in spindle assembly and cytokinesis. {ECO:0000269|PubMed:9722614}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 28_57 | 0 | 607.0 | Domain | Note=LRRNT | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 355_409 | 0 | 607.0 | Domain | Note=LRRCT | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 410_499 | 0 | 607.0 | Domain | Note=Ig-like C2-type | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 28_57 | 0 | 607.0 | Domain | Note=LRRNT | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 355_409 | 0 | 607.0 | Domain | Note=LRRCT | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 410_499 | 0 | 607.0 | Domain | Note=Ig-like C2-type | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 106_127 | 0 | 607.0 | Repeat | Note=LRR 3 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 130_151 | 0 | 607.0 | Repeat | Note=LRR 4 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 154_175 | 0 | 607.0 | Repeat | Note=LRR 5 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 178_199 | 0 | 607.0 | Repeat | Note=LRR 6 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 202_223 | 0 | 607.0 | Repeat | Note=LRR 7 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 226_247 | 0 | 607.0 | Repeat | Note=LRR 8 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 250_271 | 0 | 607.0 | Repeat | Note=LRR 9 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 274_295 | 0 | 607.0 | Repeat | Note=LRR 10 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 298_319 | 0 | 607.0 | Repeat | Note=LRR 11 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 322_343 | 0 | 607.0 | Repeat | Note=LRR 12 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 58_79 | 0 | 607.0 | Repeat | Note=LRR 1 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 82_103 | 0 | 607.0 | Repeat | Note=LRR 2 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 106_127 | 0 | 607.0 | Repeat | Note=LRR 3 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 130_151 | 0 | 607.0 | Repeat | Note=LRR 4 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 154_175 | 0 | 607.0 | Repeat | Note=LRR 5 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 178_199 | 0 | 607.0 | Repeat | Note=LRR 6 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 202_223 | 0 | 607.0 | Repeat | Note=LRR 7 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 226_247 | 0 | 607.0 | Repeat | Note=LRR 8 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 250_271 | 0 | 607.0 | Repeat | Note=LRR 9 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 274_295 | 0 | 607.0 | Repeat | Note=LRR 10 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 298_319 | 0 | 607.0 | Repeat | Note=LRR 11 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 322_343 | 0 | 607.0 | Repeat | Note=LRR 12 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 58_79 | 0 | 607.0 | Repeat | Note=LRR 1 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 82_103 | 0 | 607.0 | Repeat | Note=LRR 2 | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 28_545 | 0 | 607.0 | Topological domain | Extracellular | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 567_606 | 0 | 607.0 | Topological domain | Cytoplasmic | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 28_545 | 0 | 607.0 | Topological domain | Extracellular | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 567_606 | 0 | 607.0 | Topological domain | Cytoplasmic | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000308675 | 0 | 4 | 546_566 | 0 | 607.0 | Transmembrane | Helical | |
Tgene | LINGO2 | chr9:34618673 | chr9:28670278 | ENST00000379992 | -1 | 6 | 546_566 | 0 | 607.0 | Transmembrane | Helical |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | DCTN3 | chr9:34618673 | chr9:28670278 | ENST00000259632 | - | 2 | 7 | 135_157 | 60.333333333333336 | 187.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | DCTN3 | chr9:34618673 | chr9:28670278 | ENST00000341694 | - | 2 | 7 | 135_157 | 60.333333333333336 | 272.6666666666667 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | DCTN3 | chr9:34618673 | chr9:28670278 | ENST00000378916 | - | 2 | 6 | 135_157 | 60.333333333333336 | 159.0 | Coiled coil | Ontology_term=ECO:0000255 |
Top |
Fusion Protein Structures |
![]() * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
PDB file >>>1283_DCTN3_34618673_LINGO2_28670278_1283_DCTN3_34618673_LINGO2_28670278_ranked_0.pdb | DCTN3 | 34618673 | 34618673 | ENST00000379992 | LINGO2 | chr9 | 28670278 | - | MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSVNPEEFISYPLLEEIDLSD NIIANVEPGAFNNLFNLRSLRLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLE QLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSVTNTNLSTVPFLAFK HLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNNPLACD CRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHLLVDEGQTVQLECSADGDPQPVISWVTPRRR FITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKT | 606 |
Top |
pLDDT score distribution |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
DCTN3_pLDDT.png![]() |
LINGO2_pLDDT.png![]() |
![]() * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
![]() |
Top |
Ramachandran Plot of Fusion Protein Structure |
![]() |
Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
DCTN3 | |
LINGO2 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to DCTN3-LINGO2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to DCTN3-LINGO2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |