UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Fusion Protein:DICER1-GNL3 |
Fusion Protein Summary |
Fusion gene summary |
Fusion partner gene information | Fusion gene name: DICER1-GNL3 | FusionPDB ID: 22789 | FusionGDB2.0 ID: 22789 | Hgene | Tgene | Gene symbol | DICER1 | GNL3 | Gene ID | 23405 | 26354 |
Gene name | dicer 1, ribonuclease III | G protein nucleolar 3 | |
Synonyms | DCR1|Dicer|Dicer1e|GLOW|HERNA|K12H4.8-LIKE|MNG1|RMSE2 | C77032|E2IG3|NNP47|NS | |
Cytomap | 14q32.13 | 3p21.1 | |
Type of gene | protein-coding | protein-coding | |
Description | endoribonuclease DicerDicer1, Dcr-1 homologdicer 1, double-stranded RNA-specific endoribonucleasedicer 1, ribonuclease type IIIhelicase MOIhelicase with RNAse motif | guanine nucleotide-binding protein-like 3E2-induced gene 3 proteinestradiol-induced nucleotide binding proteinguanine nucleotide binding protein-like 3 (nucleolar)novel nucleolar protein 47nucleolar GTP-binding protein 3nucleostemin | |
Modification date | 20200329 | 20200327 | |
UniProtAcc | Q9UPY3 | Q9NVN8 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000343455, ENST00000393063, ENST00000526495, ENST00000527414, ENST00000541352, ENST00000527416, ENST00000556045, | ENST00000460073, ENST00000394799, ENST00000418458, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 13 X 8 X 10=1040 | 4 X 8 X 4=128 |
# samples | 15 | 6 | |
** MAII score | log2(15/1040*10)=-2.79354912253257 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/128*10)=-1.09310940439148 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: DICER1 [Title/Abstract] AND GNL3 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | DICER1(95590533)-GNL3(52726888), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | DICER1-GNL3 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. DICER1-GNL3 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. DICER1-GNL3 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. DICER1-GNL3 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. DICER1-GNL3 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. DICER1-GNL3 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. DICER1-GNL3 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | DICER1 | GO:0030422 | production of siRNA involved in RNA interference | 15973356|17452327|23661684 |
Hgene | DICER1 | GO:0031054 | pre-miRNA processing | 15973356|16357216|18178619|23661684|25549615 |
Hgene | DICER1 | GO:0035087 | siRNA loading onto RISC involved in RNA interference | 15973356 |
Hgene | DICER1 | GO:0035196 | production of miRNAs involved in gene silencing by miRNA | 15973356|23661684 |
Hgene | DICER1 | GO:0035280 | miRNA loading onto RISC involved in gene silencing by miRNA | 18178619 |
Hgene | DICER1 | GO:0038061 | NIK/NF-kappaB signaling | 26435691 |
Hgene | DICER1 | GO:0090502 | RNA phosphodiester bond hydrolysis, endonucleolytic | 21753850|25549615 |
Tgene | GNL3 | GO:0017145 | stem cell division | 25522312 |
Fusion gene breakpoints across DICER1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across GNL3 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | GBM | TCGA-76-4928-01B | DICER1 | chr14 | 95590533 | - | GNL3 | chr3 | 52726888 | + |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000541352 | DICER1 | chr14 | 95590533 | - | ENST00000418458 | GNL3 | chr3 | 52726888 | + | 2383 | 1385 | 9 | 2165 | 718 |
ENST00000541352 | DICER1 | chr14 | 95590533 | - | ENST00000394799 | GNL3 | chr3 | 52726888 | + | 2383 | 1385 | 9 | 2165 | 718 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000541352 | ENST00000418458 | DICER1 | chr14 | 95590533 | - | GNL3 | chr3 | 52726888 | + | 0.001312498 | 0.99868757 |
ENST00000541352 | ENST00000394799 | DICER1 | chr14 | 95590533 | - | GNL3 | chr3 | 52726888 | + | 0.001312498 | 0.99868757 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >22789_22789_1_DICER1-GNL3_DICER1_chr14_95590533_ENST00000541352_GNL3_chr3_52726888_ENST00000394799_length(amino acids)=718AA_BP=458 MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFS RNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLA ILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERL LMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCE EHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVER RYTAVVLNRSMQVVPLDKQITIIDSPSFIVSPLNSSSALALRSPASIEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTVLAQR RGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGFNLEELEKNNAQSIRAIKGPHLANSILFQSSGLTN -------------------------------------------------------------- >22789_22789_2_DICER1-GNL3_DICER1_chr14_95590533_ENST00000541352_GNL3_chr3_52726888_ENST00000418458_length(amino acids)=718AA_BP=458 MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFS RNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLA ILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERL LMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCE EHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVER RYTAVVLNRSMQVVPLDKQITIIDSPSFIVSPLNSSSALALRSPASIEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTVLAQR RGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGFNLEELEKNNAQSIRAIKGPHLANSILFQSSGLTN -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr14:95590533/chr3:52726888) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
DICER1 | GNL3 |
FUNCTION: Double-stranded RNA (dsRNA) endoribonuclease playing a central role in short dsRNA-mediated post-transcriptional gene silencing. Cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation. Gene silencing mediated by siRNAs, also called RNA interference, controls the elimination of transcripts from mobile and repetitive DNA elements of the genome but also the degradation of exogenous RNA of viral origin for instance. The miRNA pathway on the other side is a mean to specifically regulate the expression of target genes. {ECO:0000269|PubMed:15242644, ECO:0000269|PubMed:15973356, ECO:0000269|PubMed:16142218, ECO:0000269|PubMed:16271387, ECO:0000269|PubMed:16289642, ECO:0000269|PubMed:16357216, ECO:0000269|PubMed:16424907, ECO:0000269|PubMed:17452327, ECO:0000269|PubMed:18178619}. | FUNCTION: Stabilizes TERF1 telomeric association by preventing TERF1 recruitment by PML. Stabilizes TERF1 protein by preventing its ubiquitination and hence proteasomal degradation. Does so by interfering with TERF1-binding to FBXO4 E3 ubiquitin-protein ligase. Required for cell proliferation. By stabilizing TRF1 protein during mitosis, promotes metaphase-to-anaphase transition. Stabilizes MDM2 protein by preventing its ubiquitination, and hence proteasomal degradation. By acting on MDM2, may affect TP53 activity. Required for normal processing of ribosomal pre-rRNA. Binds GTP. {ECO:0000269|PubMed:16251348, ECO:0000269|PubMed:17034816, ECO:0000269|PubMed:19487455, ECO:0000269|PubMed:21132010}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000343455 | - | 8 | 27 | 51_227 | 458.6666666666667 | 1923.0 | Domain | Helicase ATP-binding |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000393063 | - | 9 | 28 | 51_227 | 458.6666666666667 | 1923.0 | Domain | Helicase ATP-binding |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000526495 | - | 10 | 29 | 51_227 | 458.6666666666667 | 1923.0 | Domain | Helicase ATP-binding |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000527414 | - | 8 | 27 | 51_227 | 458.6666666666667 | 1923.0 | Domain | Helicase ATP-binding |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000541352 | - | 7 | 25 | 51_227 | 458.6666666666667 | 1830.0 | Domain | Helicase ATP-binding |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000343455 | - | 8 | 27 | 175_178 | 458.6666666666667 | 1923.0 | Motif | Note=DECH box |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000393063 | - | 9 | 28 | 175_178 | 458.6666666666667 | 1923.0 | Motif | Note=DECH box |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000526495 | - | 10 | 29 | 175_178 | 458.6666666666667 | 1923.0 | Motif | Note=DECH box |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000527414 | - | 8 | 27 | 175_178 | 458.6666666666667 | 1923.0 | Motif | Note=DECH box |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000541352 | - | 7 | 25 | 175_178 | 458.6666666666667 | 1830.0 | Motif | Note=DECH box |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000343455 | - | 8 | 27 | 64_71 | 458.6666666666667 | 1923.0 | Nucleotide binding | ATP |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000393063 | - | 9 | 28 | 64_71 | 458.6666666666667 | 1923.0 | Nucleotide binding | ATP |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000526495 | - | 10 | 29 | 64_71 | 458.6666666666667 | 1923.0 | Nucleotide binding | ATP |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000527414 | - | 8 | 27 | 64_71 | 458.6666666666667 | 1923.0 | Nucleotide binding | ATP |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000541352 | - | 7 | 25 | 64_71 | 458.6666666666667 | 1830.0 | Nucleotide binding | ATP |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000394799 | 8 | 15 | 305_308 | 277.6666666666667 | 538.0 | Nucleotide binding | GTP | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000418458 | 8 | 15 | 305_308 | 289.6666666666667 | 550.0 | Nucleotide binding | GTP | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000394799 | 8 | 15 | 282_456 | 277.6666666666667 | 538.0 | Region | Intermediate | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000394799 | 8 | 15 | 465_543 | 277.6666666666667 | 538.0 | Region | Acidic | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000418458 | 8 | 15 | 465_543 | 289.6666666666667 | 550.0 | Region | Acidic |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000343455 | - | 8 | 27 | 1276_1403 | 458.6666666666667 | 1923.0 | Domain | RNase III 1 |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000343455 | - | 8 | 27 | 1666_1824 | 458.6666666666667 | 1923.0 | Domain | RNase III 2 |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000343455 | - | 8 | 27 | 1849_1914 | 458.6666666666667 | 1923.0 | Domain | DRBM |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000343455 | - | 8 | 27 | 433_602 | 458.6666666666667 | 1923.0 | Domain | Helicase C-terminal |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000343455 | - | 8 | 27 | 630_722 | 458.6666666666667 | 1923.0 | Domain | Dicer dsRNA-binding fold |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000343455 | - | 8 | 27 | 891_1042 | 458.6666666666667 | 1923.0 | Domain | PAZ |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000393063 | - | 9 | 28 | 1276_1403 | 458.6666666666667 | 1923.0 | Domain | RNase III 1 |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000393063 | - | 9 | 28 | 1666_1824 | 458.6666666666667 | 1923.0 | Domain | RNase III 2 |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000393063 | - | 9 | 28 | 1849_1914 | 458.6666666666667 | 1923.0 | Domain | DRBM |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000393063 | - | 9 | 28 | 433_602 | 458.6666666666667 | 1923.0 | Domain | Helicase C-terminal |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000393063 | - | 9 | 28 | 630_722 | 458.6666666666667 | 1923.0 | Domain | Dicer dsRNA-binding fold |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000393063 | - | 9 | 28 | 891_1042 | 458.6666666666667 | 1923.0 | Domain | PAZ |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000526495 | - | 10 | 29 | 1276_1403 | 458.6666666666667 | 1923.0 | Domain | RNase III 1 |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000526495 | - | 10 | 29 | 1666_1824 | 458.6666666666667 | 1923.0 | Domain | RNase III 2 |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000526495 | - | 10 | 29 | 1849_1914 | 458.6666666666667 | 1923.0 | Domain | DRBM |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000526495 | - | 10 | 29 | 433_602 | 458.6666666666667 | 1923.0 | Domain | Helicase C-terminal |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000526495 | - | 10 | 29 | 630_722 | 458.6666666666667 | 1923.0 | Domain | Dicer dsRNA-binding fold |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000526495 | - | 10 | 29 | 891_1042 | 458.6666666666667 | 1923.0 | Domain | PAZ |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000527414 | - | 8 | 27 | 1276_1403 | 458.6666666666667 | 1923.0 | Domain | RNase III 1 |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000527414 | - | 8 | 27 | 1666_1824 | 458.6666666666667 | 1923.0 | Domain | RNase III 2 |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000527414 | - | 8 | 27 | 1849_1914 | 458.6666666666667 | 1923.0 | Domain | DRBM |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000527414 | - | 8 | 27 | 433_602 | 458.6666666666667 | 1923.0 | Domain | Helicase C-terminal |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000527414 | - | 8 | 27 | 630_722 | 458.6666666666667 | 1923.0 | Domain | Dicer dsRNA-binding fold |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000527414 | - | 8 | 27 | 891_1042 | 458.6666666666667 | 1923.0 | Domain | PAZ |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000541352 | - | 7 | 25 | 1276_1403 | 458.6666666666667 | 1830.0 | Domain | RNase III 1 |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000541352 | - | 7 | 25 | 1666_1824 | 458.6666666666667 | 1830.0 | Domain | RNase III 2 |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000541352 | - | 7 | 25 | 1849_1914 | 458.6666666666667 | 1830.0 | Domain | DRBM |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000541352 | - | 7 | 25 | 433_602 | 458.6666666666667 | 1830.0 | Domain | Helicase C-terminal |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000541352 | - | 7 | 25 | 630_722 | 458.6666666666667 | 1830.0 | Domain | Dicer dsRNA-binding fold |
Hgene | DICER1 | chr14:95590533 | chr3:52726888 | ENST00000541352 | - | 7 | 25 | 891_1042 | 458.6666666666667 | 1830.0 | Domain | PAZ |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000394799 | 8 | 15 | 56_95 | 277.6666666666667 | 538.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000418458 | 8 | 15 | 56_95 | 289.6666666666667 | 550.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000394799 | 8 | 15 | 131_312 | 277.6666666666667 | 538.0 | Domain | CP-type G | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000418458 | 8 | 15 | 131_312 | 289.6666666666667 | 550.0 | Domain | CP-type G | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000394799 | 8 | 15 | 178_181 | 277.6666666666667 | 538.0 | Nucleotide binding | GTP | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000394799 | 8 | 15 | 261_268 | 277.6666666666667 | 538.0 | Nucleotide binding | GTP | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000418458 | 8 | 15 | 178_181 | 289.6666666666667 | 550.0 | Nucleotide binding | GTP | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000418458 | 8 | 15 | 261_268 | 289.6666666666667 | 550.0 | Nucleotide binding | GTP | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000394799 | 8 | 15 | 2_46 | 277.6666666666667 | 538.0 | Region | Basic | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000418458 | 8 | 15 | 282_456 | 289.6666666666667 | 550.0 | Region | Intermediate | |
Tgene | GNL3 | chr14:95590533 | chr3:52726888 | ENST00000418458 | 8 | 15 | 2_46 | 289.6666666666667 | 550.0 | Region | Basic |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
Gene | STRING network |
DICER1 | |
GNL3 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to DICER1-GNL3 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to DICER1-GNL3 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |