UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:GNAS-GAPDH |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: GNAS-GAPDH | FusionPDB ID: 33624 | FusionGDB2.0 ID: 33624 | Hgene | Tgene | Gene symbol | GNAS | GAPDH | Gene ID | 2778 | 2597 |
Gene name | GNAS complex locus | glyceraldehyde-3-phosphate dehydrogenase | |
Synonyms | AHO|C20orf45|GNAS1|GPSA|GSA|GSP|NESP|PITA3|POH|SCG6|SgVI | G3PD|GAPD|HEL-S-162eP | |
Cytomap | 20q13.32 | 12p13.31 | |
Type of gene | protein-coding | protein-coding | |
Description | protein ALEXprotein GNASprotein SCG6 (secretogranin VI)G protein subunit alpha Sadenylate cyclase-stimulating G alpha proteinalternative gene product encoded by XL-exonextra large alphas proteinguanine nucleotide binding protein (G protein), alpha | glyceraldehyde-3-phosphate dehydrogenaseOCAS, p38 componentOct1 coactivator in S phase, 38 Kd componentaging-associated gene 9 proteinepididymis secretory sperm binding protein Li 162ePpeptidyl-cysteine S-nitrosylase GAPDH | |
Modification date | 20200329 | 20200327 | |
UniProtAcc | P63092 | P04406 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000313949, ENST00000371075, ENST00000464624, ENST00000265620, ENST00000306090, ENST00000354359, ENST00000371085, ENST00000371095, ENST00000371100, ENST00000371102, ENST00000306120, ENST00000371081, ENST00000371098, ENST00000371099, | ENST00000229239, ENST00000396856, ENST00000396858, ENST00000396859, ENST00000396861, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 44 X 25 X 16=17600 | 27 X 29 X 8=6264 |
# samples | 51 | 31 | |
** MAII score | log2(51/17600*10)=-5.10893437155316 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(31/6264*10)=-4.3367440920168 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: GNAS [Title/Abstract] AND GAPDH [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | GNAS(57478846)-GAPDH(6647267), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | GNAS-GAPDH seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. GNAS-GAPDH seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. GNAS-GAPDH seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. GNAS-GAPDH seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. GNAS-GAPDH seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. GNAS-GAPDH seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. GNAS-GAPDH seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. GNAS-GAPDH seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | GAPDH | GO:0010951 | negative regulation of endopeptidase activity | 22832495 |
Tgene | GAPDH | GO:0017148 | negative regulation of translation | 23071094 |
Tgene | GAPDH | GO:0031640 | killing of cells of other organism | 22832495 |
Tgene | GAPDH | GO:0050715 | positive regulation of cytokine secretion | 22832495 |
Tgene | GAPDH | GO:0050832 | defense response to fungus | 22832495 |
Tgene | GAPDH | GO:0051873 | killing by host of symbiont cells | 22832495 |
Tgene | GAPDH | GO:0052501 | positive regulation by organism of apoptotic process in other organism involved in symbiotic interaction | 22832495 |
Tgene | GAPDH | GO:0061844 | antimicrobial humoral immune response mediated by antimicrobial peptide | 22832495 |
Tgene | GAPDH | GO:0071346 | cellular response to interferon-gamma | 15479637 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | CESC | TCGA-IR-A3LI-01A | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000371100 | GNAS | chr20 | 57478846 | + | ENST00000229239 | GAPDH | chr12 | 6647267 | + | 3184 | 2913 | 531 | 2918 | 795 |
ENST00000371100 | GNAS | chr20 | 57478846 | + | ENST00000396861 | GAPDH | chr12 | 6647267 | + | 3172 | 2913 | 531 | 2918 | 795 |
ENST00000371102 | GNAS | chr20 | 57478846 | + | ENST00000229239 | GAPDH | chr12 | 6647267 | + | 2593 | 2322 | 3 | 2327 | 774 |
ENST00000371102 | GNAS | chr20 | 57478846 | + | ENST00000396861 | GAPDH | chr12 | 6647267 | + | 2581 | 2322 | 3 | 2327 | 774 |
ENST00000371095 | GNAS | chr20 | 57478846 | + | ENST00000229239 | GAPDH | chr12 | 6647267 | + | 1086 | 815 | 823 | 2 | 274 |
ENST00000371095 | GNAS | chr20 | 57478846 | + | ENST00000396861 | GAPDH | chr12 | 6647267 | + | 1074 | 815 | 823 | 2 | 274 |
ENST00000371085 | GNAS | chr20 | 57478846 | + | ENST00000229239 | GAPDH | chr12 | 6647267 | + | 1127 | 856 | 864 | 1 | 288 |
ENST00000371085 | GNAS | chr20 | 57478846 | + | ENST00000396861 | GAPDH | chr12 | 6647267 | + | 1115 | 856 | 864 | 1 | 288 |
ENST00000354359 | GNAS | chr20 | 57478846 | + | ENST00000229239 | GAPDH | chr12 | 6647267 | + | 1130 | 859 | 867 | 1 | 289 |
ENST00000354359 | GNAS | chr20 | 57478846 | + | ENST00000396861 | GAPDH | chr12 | 6647267 | + | 1118 | 859 | 867 | 1 | 289 |
ENST00000265620 | GNAS | chr20 | 57478846 | + | ENST00000229239 | GAPDH | chr12 | 6647267 | + | 1021 | 750 | 758 | 0 | 253 |
ENST00000265620 | GNAS | chr20 | 57478846 | + | ENST00000396861 | GAPDH | chr12 | 6647267 | + | 1009 | 750 | 758 | 0 | 253 |
ENST00000306090 | GNAS | chr20 | 57478846 | + | ENST00000229239 | GAPDH | chr12 | 6647267 | + | 803 | 532 | 540 | 1 | 180 |
ENST00000306090 | GNAS | chr20 | 57478846 | + | ENST00000396861 | GAPDH | chr12 | 6647267 | + | 791 | 532 | 540 | 1 | 180 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000371100 | ENST00000229239 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.01068128 | 0.9893188 |
ENST00000371100 | ENST00000396861 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.010635193 | 0.98936486 |
ENST00000371102 | ENST00000229239 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.016691785 | 0.9833082 |
ENST00000371102 | ENST00000396861 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.016581496 | 0.9834185 |
ENST00000371095 | ENST00000229239 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.008682908 | 0.99131715 |
ENST00000371095 | ENST00000396861 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.008667513 | 0.9913325 |
ENST00000371085 | ENST00000229239 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.005251807 | 0.9947482 |
ENST00000371085 | ENST00000396861 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.005287748 | 0.99471223 |
ENST00000354359 | ENST00000229239 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.004871563 | 0.9951284 |
ENST00000354359 | ENST00000396861 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.005117199 | 0.9948828 |
ENST00000265620 | ENST00000229239 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.008899255 | 0.9911007 |
ENST00000265620 | ENST00000396861 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.009380726 | 0.9906193 |
ENST00000306090 | ENST00000229239 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.010252884 | 0.98974717 |
ENST00000306090 | ENST00000396861 | GNAS | chr20 | 57478846 | + | GAPDH | chr12 | 6647267 | + | 0.010419838 | 0.9895802 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >33624_33624_1_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000265620_GAPDH_chr12_6647267_ENST00000229239_length(amino acids)=253AA_BP= MSYGREVKVRHVHHTQDVVHSELVLGVGQLHGGHQVAHGGHNGFNRLFQVVFDVLHFGCLLISIKPINMQDPHLLHNGAFTRFSSTQQQQ AVRGPVDLLVLLQLLLDLFVGLTLRLLLVALVLGLTVPEAAHGGGGGGGARPGCGGGGRGRPHAGREGRGSAGRAGRARARLLGKERAGR -------------------------------------------------------------- >33624_33624_2_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000265620_GAPDH_chr12_6647267_ENST00000396861_length(amino acids)=253AA_BP= MSYGREVKVRHVHHTQDVVHSELVLGVGQLHGGHQVAHGGHNGFNRLFQVVFDVLHFGCLLISIKPINMQDPHLLHNGAFTRFSSTQQQQ AVRGPVDLLVLLQLLLDLFVGLTLRLLLVALVLGLTVPEAAHGGGGGGGARPGCGGGGRGRPHAGREGRGSAGRAGRARARLLGKERAGR -------------------------------------------------------------- >33624_33624_3_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000306090_GAPDH_chr12_6647267_ENST00000229239_length(amino acids)=180AA_BP= MSYGREVKVRHVHHTQDVVHSELVLGVGQLHGGHQVAHGGHNGFNRLFQVVFDVLHFGCLLTVSIKPINMQDPHLLHNGAFTRFSSTQQQ QAVRGPVDLLVLLQLLLDLFVGLTLRLLLVALVLGLTVPEAAHGGGKGRVSVGPRGARSSPPLEPRPRGLMAAAGPRRTRAGAAGAAAAA -------------------------------------------------------------- >33624_33624_4_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000306090_GAPDH_chr12_6647267_ENST00000396861_length(amino acids)=180AA_BP= MSYGREVKVRHVHHTQDVVHSELVLGVGQLHGGHQVAHGGHNGFNRLFQVVFDVLHFGCLLTVSIKPINMQDPHLLHNGAFTRFSSTQQQ QAVRGPVDLLVLLQLLLDLFVGLTLRLLLVALVLGLTVPEAAHGGGKGRVSVGPRGARSSPPLEPRPRGLMAAAGPRRTRAGAAGAAAAA -------------------------------------------------------------- >33624_33624_5_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000354359_GAPDH_chr12_6647267_ENST00000229239_length(amino acids)=289AA_BP= MSYGREVKVRHVHHTQDVVHSELVLGVGQLHGGHQVAHGGHNGFNRLFQVVFDVLHFGCLLTAIAVAPCSLRVLFAALSIKPINMQDPHL LHNGAFTRFSSTQQQQAVRGPVDLLVLLQLLLDLFVGLTLRLLLVALVLGLTVPEAAHGGGGGGGARPGCGGGGRGRPHAGREGRGSAGR AGRARARLLGKERAGRTAGRGPRGARTGGKGRVSVGPRGARSSPPLEPRPRGLMAAAGPRRTRAGAAGAAAAAAAAAALIASAGPPPPPR -------------------------------------------------------------- >33624_33624_6_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000354359_GAPDH_chr12_6647267_ENST00000396861_length(amino acids)=289AA_BP= MSYGREVKVRHVHHTQDVVHSELVLGVGQLHGGHQVAHGGHNGFNRLFQVVFDVLHFGCLLTAIAVAPCSLRVLFAALSIKPINMQDPHL LHNGAFTRFSSTQQQQAVRGPVDLLVLLQLLLDLFVGLTLRLLLVALVLGLTVPEAAHGGGGGGGARPGCGGGGRGRPHAGREGRGSAGR AGRARARLLGKERAGRTAGRGPRGARTGGKGRVSVGPRGARSSPPLEPRPRGLMAAAGPRRTRAGAAGAAAAAAAAAALIASAGPPPPPR -------------------------------------------------------------- >33624_33624_7_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000371085_GAPDH_chr12_6647267_ENST00000229239_length(amino acids)=288AA_BP= MSYGREVKVRHVHHTQDVVHSELVLGVGQLHGGHQVAHGGHNGFNRLFQVVFDVLHFGCLLTIAVAPCSLRVLFAALSIKPINMQDPHLL HNGAFTRFSSTQQQQAVRGPVDLLVLLQLLLDLFVGLTLRLLLVALVLGLTVPEAAHGGGGGGGARPGCGGGGRGRPHAGREGRGSAGRA GRARARLLGKERAGRTAGRGPRGARTGGKGRVSVGPRGARSSPPLEPRPRGLMAAAGPRRTRAGAAGAAAAAAAAAALIASAGPPPPPRA -------------------------------------------------------------- >33624_33624_8_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000371085_GAPDH_chr12_6647267_ENST00000396861_length(amino acids)=288AA_BP= MSYGREVKVRHVHHTQDVVHSELVLGVGQLHGGHQVAHGGHNGFNRLFQVVFDVLHFGCLLTIAVAPCSLRVLFAALSIKPINMQDPHLL HNGAFTRFSSTQQQQAVRGPVDLLVLLQLLLDLFVGLTLRLLLVALVLGLTVPEAAHGGGGGGGARPGCGGGGRGRPHAGREGRGSAGRA GRARARLLGKERAGRTAGRGPRGARTGGKGRVSVGPRGARSSPPLEPRPRGLMAAAGPRRTRAGAAGAAAAAAAAAALIASAGPPPPPRA -------------------------------------------------------------- >33624_33624_9_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000371095_GAPDH_chr12_6647267_ENST00000229239_length(amino acids)=274AA_BP= MSYGREVKVRHVHHTQDVVHSELVLGVGQLHGGHQVAHGGHNGFNRLFQVVFDVLHFGCLLTVSIKPINMQDPHLLHNGAFTRFSSTQQQ QAVRGPVDLLVLLQLLLDLFVGLTLRLLLVALVLGLTVPEAAHGGGGGGGARPGCGGGGRGRPHAGREGRGSAGRAGRARARLLGKERAG RTAGRGPRGARTGGKGRVSVGPRGARSSPPLEPRPRGLMAAAGPRRTRAGAAGAAAAAAAAAALIASAGPPPPPRAKSAAAGGGRRGEEE -------------------------------------------------------------- >33624_33624_10_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000371095_GAPDH_chr12_6647267_ENST00000396861_length(amino acids)=274AA_BP= MSYGREVKVRHVHHTQDVVHSELVLGVGQLHGGHQVAHGGHNGFNRLFQVVFDVLHFGCLLTVSIKPINMQDPHLLHNGAFTRFSSTQQQ QAVRGPVDLLVLLQLLLDLFVGLTLRLLLVALVLGLTVPEAAHGGGGGGGARPGCGGGGRGRPHAGREGRGSAGRAGRARARLLGKERAG RTAGRGPRGARTGGKGRVSVGPRGARSSPPLEPRPRGLMAAAGPRRTRAGAAGAAAAAAAAAALIASAGPPPPPRAKSAAAGGGRRGEEE -------------------------------------------------------------- >33624_33624_11_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000371100_GAPDH_chr12_6647267_ENST00000229239_length(amino acids)=795AA_BP= MRGRHRVMGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNP AFREAGAHGSYSPPPEEAMPFEAEQPSLGGFWPTLEQPGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRG CSQLLLQVPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPPGLSRVIAQVDGSSQFAAVAASSA VRLTPAANAPPLWVPGAIGSPSQEAVRPPSNFTGSSPWMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPP VEEEAAEMEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADPDSGAFAADPDSGAAPAAPADPDS GAAPDAPADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSP EIQAADPPTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRS ESPQPKASRSLKVKKVPLAEKRRQMRKEALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNG -------------------------------------------------------------- >33624_33624_12_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000371100_GAPDH_chr12_6647267_ENST00000396861_length(amino acids)=795AA_BP= MRGRHRVMGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNP AFREAGAHGSYSPPPEEAMPFEAEQPSLGGFWPTLEQPGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRG CSQLLLQVPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPPGLSRVIAQVDGSSQFAAVAASSA VRLTPAANAPPLWVPGAIGSPSQEAVRPPSNFTGSSPWMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPP VEEEAAEMEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADPDSGAFAADPDSGAAPAAPADPDS GAAPDAPADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSP EIQAADPPTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRS ESPQPKASRSLKVKKVPLAEKRRQMRKEALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNG -------------------------------------------------------------- >33624_33624_13_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000371102_GAPDH_chr12_6647267_ENST00000229239_length(amino acids)=774AA_BP= MGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGA HGSYSPPPEEAMPFEAEQPSLGGFWPTLEQPGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRGCSQLLLQ VPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPPGLSRVIAQVDGSSQFAAVAASSAVRLTPAA NAPPLWVPGAIGSPSQEAVRPPSNFTGSSPWMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE MEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADPDSGAFAADPDSGAAPAAPADPDSGAAPDAP ADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQAADP PTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKA SRSLKVKKVPLAEKRRQMRKEALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGDSEKATK -------------------------------------------------------------- >33624_33624_14_GNAS-GAPDH_GNAS_chr20_57478846_ENST00000371102_GAPDH_chr12_6647267_ENST00000396861_length(amino acids)=774AA_BP= MGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGA HGSYSPPPEEAMPFEAEQPSLGGFWPTLEQPGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRGCSQLLLQ VPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPPGLSRVIAQVDGSSQFAAVAASSAVRLTPAA NAPPLWVPGAIGSPSQEAVRPPSNFTGSSPWMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAE MEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADPDSGAFAADPDSGAAPAAPADPDSGAAPDAP ADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQAADP PTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKA SRSLKVKKVPLAEKRRQMRKEALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGDSEKATK -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr20:57478846/chr12:6647267) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
GNAS | GAPDH |
FUNCTION: Guanine nucleotide-binding proteins (G proteins) function as transducers in numerous signaling pathways controlled by G protein-coupled receptors (GPCRs) (PubMed:17110384). Signaling involves the activation of adenylyl cyclases, resulting in increased levels of the signaling molecule cAMP (PubMed:26206488, PubMed:8702665). GNAS functions downstream of several GPCRs, including beta-adrenergic receptors (PubMed:21488135). Stimulates the Ras signaling pathway via RAPGEF2 (PubMed:12391161). {ECO:0000269|PubMed:12391161, ECO:0000269|PubMed:17110384, ECO:0000269|PubMed:21488135, ECO:0000269|PubMed:26206488, ECO:0000269|PubMed:8702665}. | FUNCTION: Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC. Modulates the organization and assembly of the cytoskeleton. Facilitates the CHP1-dependent microtubule and membrane associations through its ability to stimulate the binding of CHP1 to microtubules (By similarity). Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Component of the GAIT (gamma interferon-activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma treatment assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation. {ECO:0000250, ECO:0000269|PubMed:11724794, ECO:0000269|PubMed:23071094, ECO:0000269|PubMed:3170585}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 641_667 | 787.0 | 1038.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 730_756 | 787.0 | 1038.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 641_667 | 773.0 | 1024.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 730_756 | 773.0 | 1024.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000313949 | + | 5 | 13 | 78_142 | 357.6666666666667 | 26.333333333333332 | Compositional bias | Glu-rich |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371075 | + | 5 | 13 | 78_142 | 358.6666666666667 | 36.333333333333336 | Compositional bias | Glu-rich |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 358_522 | 787.0 | 1038.0 | Compositional bias | Ala-rich |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 358_522 | 773.0 | 1024.0 | Compositional bias | Ala-rich |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000265620 | + | 4 | 12 | 47_55 | 129.0 | 380.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000306090 | + | 5 | 13 | 47_55 | 130.0 | 381.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000354359 | + | 5 | 13 | 47_55 | 145.0 | 396.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371085 | + | 5 | 13 | 47_55 | 144.0 | 395.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371095 | + | 4 | 12 | 47_55 | 130.0 | 381.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 690_698 | 787.0 | 1038.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 690_698 | 773.0 | 1024.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000265620 | + | 4 | 12 | 42_55 | 129.0 | 380.0 | Region | G1 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000306090 | + | 5 | 13 | 42_55 | 130.0 | 381.0 | Region | G1 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000354359 | + | 5 | 13 | 42_55 | 145.0 | 396.0 | Region | G1 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371085 | + | 5 | 13 | 42_55 | 144.0 | 395.0 | Region | G1 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371095 | + | 4 | 12 | 42_55 | 130.0 | 381.0 | Region | G1 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 685_698 | 787.0 | 1038.0 | Region | G1 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 685_698 | 773.0 | 1024.0 | Region | G1 motif |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000306120 | + | 1 | 1 | 238_476 | 0.0 | 626.0 | Compositional bias | Pro-rich |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371098 | + | 1 | 4 | 78_142 | 0 | 20.333333333333332 | Compositional bias | Glu-rich |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000265620 | + | 4 | 12 | 39_394 | 129.0 | 380.0 | Domain | G-alpha |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000306090 | + | 5 | 13 | 39_394 | 130.0 | 381.0 | Domain | G-alpha |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000354359 | + | 5 | 13 | 39_394 | 145.0 | 396.0 | Domain | G-alpha |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371085 | + | 5 | 13 | 39_394 | 144.0 | 395.0 | Domain | G-alpha |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371095 | + | 4 | 12 | 39_394 | 130.0 | 381.0 | Domain | G-alpha |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 682_1037 | 787.0 | 1038.0 | Domain | G-alpha |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 682_1037 | 773.0 | 1024.0 | Domain | G-alpha |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000265620 | + | 4 | 12 | 197_204 | 129.0 | 380.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000265620 | + | 4 | 12 | 223_227 | 129.0 | 380.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000265620 | + | 4 | 12 | 292_295 | 129.0 | 380.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000306090 | + | 5 | 13 | 197_204 | 130.0 | 381.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000306090 | + | 5 | 13 | 223_227 | 130.0 | 381.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000306090 | + | 5 | 13 | 292_295 | 130.0 | 381.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000354359 | + | 5 | 13 | 197_204 | 145.0 | 396.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000354359 | + | 5 | 13 | 223_227 | 145.0 | 396.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000354359 | + | 5 | 13 | 292_295 | 145.0 | 396.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371085 | + | 5 | 13 | 197_204 | 144.0 | 395.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371085 | + | 5 | 13 | 223_227 | 144.0 | 395.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371085 | + | 5 | 13 | 292_295 | 144.0 | 395.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371095 | + | 4 | 12 | 197_204 | 130.0 | 381.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371095 | + | 4 | 12 | 223_227 | 130.0 | 381.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371095 | + | 4 | 12 | 292_295 | 130.0 | 381.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 840_847 | 787.0 | 1038.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 866_870 | 787.0 | 1038.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 935_938 | 787.0 | 1038.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 840_847 | 773.0 | 1024.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 866_870 | 773.0 | 1024.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 935_938 | 773.0 | 1024.0 | Nucleotide binding | GTP |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000265620 | + | 4 | 12 | 196_204 | 129.0 | 380.0 | Region | G2 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000265620 | + | 4 | 12 | 219_228 | 129.0 | 380.0 | Region | G3 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000265620 | + | 4 | 12 | 288_295 | 129.0 | 380.0 | Region | G4 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000265620 | + | 4 | 12 | 364_369 | 129.0 | 380.0 | Region | G5 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000306090 | + | 5 | 13 | 196_204 | 130.0 | 381.0 | Region | G2 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000306090 | + | 5 | 13 | 219_228 | 130.0 | 381.0 | Region | G3 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000306090 | + | 5 | 13 | 288_295 | 130.0 | 381.0 | Region | G4 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000306090 | + | 5 | 13 | 364_369 | 130.0 | 381.0 | Region | G5 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000354359 | + | 5 | 13 | 196_204 | 145.0 | 396.0 | Region | G2 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000354359 | + | 5 | 13 | 219_228 | 145.0 | 396.0 | Region | G3 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000354359 | + | 5 | 13 | 288_295 | 145.0 | 396.0 | Region | G4 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000354359 | + | 5 | 13 | 364_369 | 145.0 | 396.0 | Region | G5 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371085 | + | 5 | 13 | 196_204 | 144.0 | 395.0 | Region | G2 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371085 | + | 5 | 13 | 219_228 | 144.0 | 395.0 | Region | G3 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371085 | + | 5 | 13 | 288_295 | 144.0 | 395.0 | Region | G4 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371085 | + | 5 | 13 | 364_369 | 144.0 | 395.0 | Region | G5 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371095 | + | 4 | 12 | 196_204 | 130.0 | 381.0 | Region | G2 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371095 | + | 4 | 12 | 219_228 | 130.0 | 381.0 | Region | G3 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371095 | + | 4 | 12 | 288_295 | 130.0 | 381.0 | Region | G4 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371095 | + | 4 | 12 | 364_369 | 130.0 | 381.0 | Region | G5 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 1007_1012 | 787.0 | 1038.0 | Region | G5 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 839_847 | 787.0 | 1038.0 | Region | G2 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 862_871 | 787.0 | 1038.0 | Region | G3 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371100 | + | 5 | 13 | 931_938 | 787.0 | 1038.0 | Region | G4 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 1007_1012 | 773.0 | 1024.0 | Region | G5 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 839_847 | 773.0 | 1024.0 | Region | G2 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 862_871 | 773.0 | 1024.0 | Region | G3 motif |
Hgene | GNAS | chr20:57478846 | chr12:6647267 | ENST00000371102 | + | 4 | 12 | 931_938 | 773.0 | 1024.0 | Region | G4 motif |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000229239 | 7 | 9 | 245_250 | 312.6666666666667 | 336.0 | Motif | [IL]-x-C-x-x-[DE] motif | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396858 | 6 | 8 | 245_250 | 270.6666666666667 | 294.0 | Motif | [IL]-x-C-x-x-[DE] motif | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396859 | 6 | 8 | 245_250 | 312.6666666666667 | 336.0 | Motif | [IL]-x-C-x-x-[DE] motif | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396861 | 7 | 9 | 245_250 | 312.6666666666667 | 336.0 | Motif | [IL]-x-C-x-x-[DE] motif | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000229239 | 7 | 9 | 13_14 | 312.6666666666667 | 336.0 | Nucleotide binding | NAD | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396858 | 6 | 8 | 13_14 | 270.6666666666667 | 294.0 | Nucleotide binding | NAD | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396859 | 6 | 8 | 13_14 | 312.6666666666667 | 336.0 | Nucleotide binding | NAD | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396861 | 7 | 9 | 13_14 | 312.6666666666667 | 336.0 | Nucleotide binding | NAD | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000229239 | 7 | 9 | 151_153 | 312.6666666666667 | 336.0 | Region | Glyceraldehyde 3-phosphate binding | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000229239 | 7 | 9 | 211_212 | 312.6666666666667 | 336.0 | Region | Glyceraldehyde 3-phosphate binding | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396858 | 6 | 8 | 151_153 | 270.6666666666667 | 294.0 | Region | Glyceraldehyde 3-phosphate binding | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396858 | 6 | 8 | 211_212 | 270.6666666666667 | 294.0 | Region | Glyceraldehyde 3-phosphate binding | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396859 | 6 | 8 | 151_153 | 312.6666666666667 | 336.0 | Region | Glyceraldehyde 3-phosphate binding | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396859 | 6 | 8 | 211_212 | 312.6666666666667 | 336.0 | Region | Glyceraldehyde 3-phosphate binding | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396861 | 7 | 9 | 151_153 | 312.6666666666667 | 336.0 | Region | Glyceraldehyde 3-phosphate binding | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396861 | 7 | 9 | 211_212 | 312.6666666666667 | 336.0 | Region | Glyceraldehyde 3-phosphate binding |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
GNAS | |
GAPDH |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000229239 | 7 | 9 | 2_148 | 312.6666666666667 | 336.0 | WARS1 | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396858 | 6 | 8 | 2_148 | 270.6666666666667 | 294.0 | WARS1 | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396859 | 6 | 8 | 2_148 | 312.6666666666667 | 336.0 | WARS1 | |
Tgene | GAPDH | chr20:57478846 | chr12:6647267 | ENST00000396861 | 7 | 9 | 2_148 | 312.6666666666667 | 336.0 | WARS1 |
Top |
Related Drugs to GNAS-GAPDH |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to GNAS-GAPDH |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |