UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:GPR89B-CAPN2 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: GPR89B-CAPN2 | FusionPDB ID: 34476 | FusionGDB2.0 ID: 34476 | Hgene | Tgene | Gene symbol | GPR89B | CAPN2 | Gene ID | 653519 | 824 |
Gene name | G protein-coupled receptor 89A | calpain 2 | |
Synonyms | GPHR|GPR89|GPR89B|SH120|UNQ192 | CANP2|CANPL2|CANPml|mCANP | |
Cytomap | 1q21.1 | 1q41 | |
Type of gene | protein-coding | protein-coding | |
Description | Golgi pH regulator Aprotein GPR89putative MAPK-activating protein PM01putative NF-kappa-B-activating protein 90 | calpain-2 catalytic subunitCANP 2M-calpaincalcium-activated neutral proteinase 2calpain 2, (m/II) large subunitcalpain 2, large [catalytic] subunitcalpain 2, large subunitcalpain M-typecalpain, large polypeptide L2millimolar-calpain | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | P0CG08 | P17655 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000488603, ENST00000314163, | ENST00000295006, ENST00000433674, ENST00000474026, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 6 X 3 X 4=72 | 11 X 7 X 7=539 |
# samples | 6 | 11 | |
** MAII score | log2(6/72*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(11/539*10)=-2.29278174922785 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: GPR89B [Title/Abstract] AND CAPN2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | GPR89B(147460753)-CAPN2(223946971), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | GPR89B-CAPN2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. GPR89B-CAPN2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. GPR89B-CAPN2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. GPR89B-CAPN2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | GPR89B | GO:0051452 | intracellular pH reduction | 18794847 |
Tgene | CAPN2 | GO:0051603 | proteolysis involved in cellular protein catabolic process | 12150984 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | Non-Cancer | 61N | GPR89B | chr1 | 147460753 | + | CAPN2 | chr1 | 223946971 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000314163 | GPR89B | chr1 | 147460753 | + | ENST00000433674 | CAPN2 | chr1 | 223946971 | + | 3184 | 1239 | 75 | 2024 | 649 |
ENST00000314163 | GPR89B | chr1 | 147460753 | + | ENST00000295006 | CAPN2 | chr1 | 223946971 | + | 3186 | 1239 | 75 | 2024 | 649 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000314163 | ENST00000433674 | GPR89B | chr1 | 147460753 | + | CAPN2 | chr1 | 223946971 | + | 0.00189742 | 0.9981026 |
ENST00000314163 | ENST00000295006 | GPR89B | chr1 | 147460753 | + | CAPN2 | chr1 | 223946971 | + | 0.001897845 | 0.9981021 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >34476_34476_1_GPR89B-CAPN2_GPR89B_chr1_147460753_ENST00000314163_CAPN2_chr1_223946971_ENST00000295006_length(amino acids)=649AA_BP=388 MWPQRAVASGSGKWRQEPSLHFAMSFLIDSSIMITSQILFFGFGWLFFMRQLFKDYEIRQYVVQVIFSVTFAFSCTMFELIIFEILGVLN SSSRYFHWKMNLCVILLILVFMVPFYIGYFIVSNIRLLHKQRLLFSCLLWLTFMYFFWKLGDPFPILSPKHGILSIEQLISRVGVIGVTL MALLSGFGAVNCPYTYMSYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLI QQEVDALEELSRQLFLETADLYATKERIEYSKTFKGKYFNFLGYFFSIYCVWKIFMATINIVFDRVGKTDPVTRGIEITVNYLGIQFDVK FWSQHISFILVGIIIVTSIRGLLITLTKLSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFCIRV FSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGK LGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKIFKQLDP -------------------------------------------------------------- >34476_34476_2_GPR89B-CAPN2_GPR89B_chr1_147460753_ENST00000314163_CAPN2_chr1_223946971_ENST00000433674_length(amino acids)=649AA_BP=388 MWPQRAVASGSGKWRQEPSLHFAMSFLIDSSIMITSQILFFGFGWLFFMRQLFKDYEIRQYVVQVIFSVTFAFSCTMFELIIFEILGVLN SSSRYFHWKMNLCVILLILVFMVPFYIGYFIVSNIRLLHKQRLLFSCLLWLTFMYFFWKLGDPFPILSPKHGILSIEQLISRVGVIGVTL MALLSGFGAVNCPYTYMSYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLI QQEVDALEELSRQLFLETADLYATKERIEYSKTFKGKYFNFLGYFFSIYCVWKIFMATINIVFDRVGKTDPVTRGIEITVNYLGIQFDVK FWSQHISFILVGIIIVTSIRGLLITLTKLSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFCIRV FSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGK LGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKIFKQLDP -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:147460753/chr1:223946971) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
GPR89B | CAPN2 |
FUNCTION: Voltage dependent anion channel required for acidification and functions of the Golgi apparatus that may function in counter-ion conductance (PubMed:18794847). Plays a role in lymphocyte development, probably by acting as a RABL3 effector in hematopoietic cells (By similarity). {ECO:0000250|UniProtKB:Q8BS95, ECO:0000269|PubMed:18794847}. | FUNCTION: Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Proteolytically cleaves MYOC at 'Arg-226' (PubMed:17650508). Proteolytically cleaves CPEB3 following neuronal stimulation which abolishes CPEB3 translational repressor activity, leading to translation of CPEB3 target mRNAs (By similarity). {ECO:0000250|UniProtKB:O08529, ECO:0000269|PubMed:17650508}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | GPR89B | chr1:147460753 | chr1:223946971 | ENST00000314163 | + | 12 | 14 | 114_134 | 365.0 | 456.0 | Transmembrane | Helical |
Hgene | GPR89B | chr1:147460753 | chr1:223946971 | ENST00000314163 | + | 12 | 14 | 150_170 | 365.0 | 456.0 | Transmembrane | Helical |
Hgene | GPR89B | chr1:147460753 | chr1:223946971 | ENST00000314163 | + | 12 | 14 | 290_310 | 365.0 | 456.0 | Transmembrane | Helical |
Hgene | GPR89B | chr1:147460753 | chr1:223946971 | ENST00000314163 | + | 12 | 14 | 343_363 | 365.0 | 456.0 | Transmembrane | Helical |
Hgene | GPR89B | chr1:147460753 | chr1:223946971 | ENST00000314163 | + | 12 | 14 | 46_66 | 365.0 | 456.0 | Transmembrane | Helical |
Hgene | GPR89B | chr1:147460753 | chr1:223946971 | ENST00000314163 | + | 12 | 14 | 5_25 | 365.0 | 456.0 | Transmembrane | Helical |
Hgene | GPR89B | chr1:147460753 | chr1:223946971 | ENST00000314163 | + | 12 | 14 | 79_99 | 365.0 | 456.0 | Transmembrane | Helical |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000295006 | 10 | 21 | 585_596 | 439.0 | 701.0 | Calcium binding | Note=1 | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000295006 | 10 | 21 | 615_626 | 439.0 | 701.0 | Calcium binding | Note=2 | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000433674 | 10 | 21 | 585_596 | 361.0 | 623.0 | Calcium binding | Note=1 | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000433674 | 10 | 21 | 615_626 | 361.0 | 623.0 | Calcium binding | Note=2 | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000295006 | 10 | 21 | 572_605 | 439.0 | 701.0 | Domain | EF-hand 1 | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000295006 | 10 | 21 | 602_637 | 439.0 | 701.0 | Domain | EF-hand 2 | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000295006 | 10 | 21 | 667_700 | 439.0 | 701.0 | Domain | EF-hand 3 | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000433674 | 10 | 21 | 572_605 | 361.0 | 623.0 | Domain | EF-hand 1 | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000433674 | 10 | 21 | 602_637 | 361.0 | 623.0 | Domain | EF-hand 2 | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000433674 | 10 | 21 | 667_700 | 361.0 | 623.0 | Domain | EF-hand 3 | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000295006 | 10 | 21 | 515_529 | 439.0 | 701.0 | Region | Note=Linker | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000295006 | 10 | 21 | 530_700 | 439.0 | 701.0 | Region | Note=Domain IV | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000433674 | 10 | 21 | 515_529 | 361.0 | 623.0 | Region | Note=Linker | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000433674 | 10 | 21 | 530_700 | 361.0 | 623.0 | Region | Note=Domain IV |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | GPR89B | chr1:147460753 | chr1:223946971 | ENST00000314163 | + | 12 | 14 | 378_398 | 365.0 | 456.0 | Transmembrane | Helical |
Hgene | GPR89B | chr1:147460753 | chr1:223946971 | ENST00000314163 | + | 12 | 14 | 425_445 | 365.0 | 456.0 | Transmembrane | Helical |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000295006 | 10 | 21 | 45_344 | 439.0 | 701.0 | Domain | Calpain catalytic | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000433674 | 10 | 21 | 45_344 | 361.0 | 623.0 | Domain | Calpain catalytic | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000295006 | 10 | 21 | 345_514 | 439.0 | 701.0 | Region | Note=Domain III | |
Tgene | CAPN2 | chr1:147460753 | chr1:223946971 | ENST00000433674 | 10 | 21 | 345_514 | 361.0 | 623.0 | Region | Note=Domain III |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
GPR89B | |
CAPN2 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to GPR89B-CAPN2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to GPR89B-CAPN2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |