UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Fusion Protein:AKR1C3-AKR1E2 |
Fusion Protein Summary |
Fusion gene summary |
Fusion partner gene information | Fusion gene name: AKR1C3-AKR1E2 | FusionPDB ID: 3448 | FusionGDB2.0 ID: 3448 | Hgene | Tgene | Gene symbol | AKR1C3 | AKR1E2 | Gene ID | 8644 | 83592 |
Gene name | aldo-keto reductase family 1 member C3 | aldo-keto reductase family 1 member E2 | |
Synonyms | DD3|DDX|HA1753|HAKRB|HAKRe|HSD17B5|PGFS|hluPGFS | AKR1CL2|AKRDC1|LoopADR|TAKR|hTSP|htAKR | |
Cytomap | 10p15.1 | 10p15.1 | |
Type of gene | protein-coding | protein-coding | |
Description | aldo-keto reductase family 1 member C33-alpha hydroxysteroid dehydrogenase, type II3-alpha-HSD type II, brainchlordecone reductase homolog HAKRbdihydrodiol dehydrogenase 3dihydrodiol dehydrogenase Xindanol dehydrogenaseprostaglandin F synthasetest | 1,5-anhydro-D-fructose reductaseAF reductasealdo-keto reductase family 1 member C-like protein 2aldo-keto reductase family 1, member C-like 2aldo-keto reductase loopADRtestis aldo-keto reductasetestis-specific protein | |
Modification date | 20200320 | 20200313 | |
UniProtAcc | P42330 | Q96JD6 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000380554, ENST00000439082, ENST00000605149, ENST00000470862, | ENST00000334019, ENST00000345253, ENST00000525281, ENST00000532248, ENST00000298375, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 2 X 3 X 2=12 | 6 X 3 X 6=108 |
# samples | 3 | 8 | |
** MAII score | log2(3/12*10)=1.32192809488736 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(8/108*10)=-0.432959407276106 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: AKR1C3 [Title/Abstract] AND AKR1E2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | AKR1C3(5144842)-AKR1E2(4877867), # samples:1 AKR1C3(5139742)-AKR1E2(4872867), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | AKR1C3 | GO:0007186 | G protein-coupled receptor signaling pathway | 18508192 |
Hgene | AKR1C3 | GO:0008284 | positive regulation of cell proliferation | 18508192|20036328 |
Hgene | AKR1C3 | GO:0010942 | positive regulation of cell death | 21787718 |
Hgene | AKR1C3 | GO:0016488 | farnesol catabolic process | 21187079 |
Hgene | AKR1C3 | GO:0034614 | cellular response to reactive oxygen species | 21787718 |
Hgene | AKR1C3 | GO:0042448 | progesterone metabolic process | 21232532 |
Hgene | AKR1C3 | GO:0042574 | retinal metabolic process | 21851338 |
Hgene | AKR1C3 | GO:0048385 | regulation of retinoic acid receptor signaling pathway | 21851338 |
Hgene | AKR1C3 | GO:0051897 | positive regulation of protein kinase B signaling | 18508192 |
Hgene | AKR1C3 | GO:0055114 | oxidation-reduction process | 16983398|19442656|21232532 |
Hgene | AKR1C3 | GO:0071276 | cellular response to cadmium ion | 21787718 |
Hgene | AKR1C3 | GO:0071277 | cellular response to calcium ion | 22170488 |
Hgene | AKR1C3 | GO:0071379 | cellular response to prostaglandin stimulus | 22170488 |
Hgene | AKR1C3 | GO:0071384 | cellular response to corticosteroid stimulus | 19336506 |
Hgene | AKR1C3 | GO:0071395 | cellular response to jasmonic acid stimulus | 19487289 |
Hgene | AKR1C3 | GO:0071799 | cellular response to prostaglandin D stimulus | 18508192 |
Hgene | AKR1C3 | GO:1900053 | negative regulation of retinoic acid biosynthetic process | 21851338 |
Hgene | AKR1C3 | GO:2000353 | positive regulation of endothelial cell apoptotic process | 19442656 |
Hgene | AKR1C3 | GO:2000379 | positive regulation of reactive oxygen species metabolic process | 19442656 |
Tgene | AKR1E2 | GO:0055114 | oxidation-reduction process | 15118078 |
Fusion gene breakpoints across AKR1C3 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across AKR1E2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LUSC | TCGA-66-2759-01A | AKR1C3 | chr10 | 5144842 | + | AKR1E2 | chr10 | 4877867 | + |
ChimerDB4 | LUSC | TCGA-68-A59J-01A | AKR1C3 | chr10 | 5139742 | + | AKR1E2 | chr10 | 4872867 | + |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000605149 | AKR1C3 | chr10 | 5144842 | + | ENST00000298375 | AKR1E2 | chr10 | 4877867 | + | 2273 | 1102 | 325 | 1740 | 471 |
ENST00000439082 | AKR1C3 | chr10 | 5144842 | + | ENST00000298375 | AKR1E2 | chr10 | 4877867 | + | 2130 | 959 | 182 | 1597 | 471 |
ENST00000380554 | AKR1C3 | chr10 | 5144842 | + | ENST00000298375 | AKR1E2 | chr10 | 4877867 | + | 2669 | 1498 | 652 | 2136 | 494 |
ENST00000605149 | AKR1C3 | chr10 | 5139742 | + | ENST00000298375 | AKR1E2 | chr10 | 4872867 | + | 2081 | 625 | 325 | 1548 | 407 |
ENST00000439082 | AKR1C3 | chr10 | 5139742 | + | ENST00000298375 | AKR1E2 | chr10 | 4872867 | + | 1938 | 482 | 182 | 1405 | 407 |
ENST00000380554 | AKR1C3 | chr10 | 5139742 | + | ENST00000298375 | AKR1E2 | chr10 | 4872867 | + | 2477 | 1021 | 652 | 1944 | 430 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000605149 | ENST00000298375 | AKR1C3 | chr10 | 5144842 | + | AKR1E2 | chr10 | 4877867 | + | 0.001116619 | 0.9988834 |
ENST00000439082 | ENST00000298375 | AKR1C3 | chr10 | 5144842 | + | AKR1E2 | chr10 | 4877867 | + | 0.001442648 | 0.9985574 |
ENST00000380554 | ENST00000298375 | AKR1C3 | chr10 | 5144842 | + | AKR1E2 | chr10 | 4877867 | + | 0.000434898 | 0.99956506 |
ENST00000605149 | ENST00000298375 | AKR1C3 | chr10 | 5139742 | + | AKR1E2 | chr10 | 4872867 | + | 0.00061322 | 0.9993868 |
ENST00000439082 | ENST00000298375 | AKR1C3 | chr10 | 5139742 | + | AKR1E2 | chr10 | 4872867 | + | 0.000788401 | 0.99921155 |
ENST00000380554 | ENST00000298375 | AKR1C3 | chr10 | 5139742 | + | AKR1E2 | chr10 | 4872867 | + | 0.000628977 | 0.999371 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >3448_3448_1_AKR1C3-AKR1E2_AKR1C3_chr10_5139742_ENST00000380554_AKR1E2_chr10_4872867_ENST00000298375_length(amino acids)=430AA_BP=121 MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFH RPELVRPALENSLKKAQLDYVDLYLIHSPMSLKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKL WCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVI TGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPA -------------------------------------------------------------- >3448_3448_2_AKR1C3-AKR1E2_AKR1C3_chr10_5139742_ENST00000439082_AKR1E2_chr10_4872867_ENST00000298375_length(amino acids)=407AA_BP=98 MQISQVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDL YLIHSPMSLKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKL NYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNK PGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSH -------------------------------------------------------------- >3448_3448_3_AKR1C3-AKR1E2_AKR1C3_chr10_5139742_ENST00000605149_AKR1E2_chr10_4872867_ENST00000298375_length(amino acids)=407AA_BP=98 MQISQVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDL YLIHSPMSLKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKL NYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNK PGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSH -------------------------------------------------------------- >3448_3448_4_AKR1C3-AKR1E2_AKR1C3_chr10_5144842_ENST00000380554_AKR1E2_chr10_4877867_ENST00000298375_length(amino acids)=494AA_BP=281 MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFH RPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAK SYNEQRIRQNVQPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGL RFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKE -------------------------------------------------------------- >3448_3448_5_AKR1C3-AKR1E2_AKR1C3_chr10_5144842_ENST00000439082_AKR1E2_chr10_4877867_ENST00000298375_length(amino acids)=471AA_BP=258 MQISQVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDL YLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLL DFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQPPHPEWIMSCS ELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISF CQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRN -------------------------------------------------------------- >3448_3448_6_AKR1C3-AKR1E2_AKR1C3_chr10_5144842_ENST00000605149_AKR1E2_chr10_4877867_ENST00000298375_length(amino acids)=471AA_BP=258 MQISQVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDL YLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLL DFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQPPHPEWIMSCS ELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISF CQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRN -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr10:5144842/chr10:4877867) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
AKR1C3 | AKR1E2 |
FUNCTION: Cytosolic aldo-keto reductase that catalyzes the NADH and NADPH-dependent reduction of ketosteroids to hydroxysteroids. Acts as a NAD(P)(H)-dependent 3-, 17- and 20-ketosteroid reductase on the steroid nucleus and side chain and regulates the metabolism of androgens, estrogens and progesterone (PubMed:10622721, PubMed:11165022, PubMed:7650035, PubMed:9415401, PubMed:9927279). Displays the ability to catalyze both oxidation and reduction in vitro, but most probably acts as a reductase in vivo since the oxidase activity measured in vitro is inhibited by physiological concentration of NADPH (PubMed:14672942, PubMed:11165022). Acts preferentially as a 17-ketosteroid reductase and has the highest catalytic efficiency of the AKR1C enzyme for the reduction of delta4-androstenedione to form testosterone (PubMed:20036328). Reduces prostaglandin (PG) D2 to 11beta-prostaglandin F2, progesterone to 20alpha-hydroxyprogesterone and estrone to 17beta-estradiol (PubMed:15047184, PubMed:20036328, PubMed:10622721, PubMed:11165022, PubMed:10998348, PubMed:19010934). Catalyzes the transformation of the potent androgen dihydrotestosterone (DHT) into the less active form, 5-alpha-androstan-3-alpha,17-beta-diol (3-alpha-diol) (PubMed:10998348, PubMed:14672942, PubMed:11165022, PubMed:7650035, PubMed:9415401, PubMed:10557352). Displays also retinaldehyde reductase activity toward 9-cis-retinal (PubMed:21851338). {ECO:0000269|PubMed:10557352, ECO:0000269|PubMed:10622721, ECO:0000269|PubMed:10998348, ECO:0000269|PubMed:11165022, ECO:0000269|PubMed:14672942, ECO:0000269|PubMed:15047184, ECO:0000269|PubMed:19010934, ECO:0000269|PubMed:20036328, ECO:0000269|PubMed:21851338, ECO:0000269|PubMed:7650035, ECO:0000269|PubMed:9415401, ECO:0000269|PubMed:9927279}. | FUNCTION: Catalyzes the NADPH-dependent reduction of 1,5-anhydro-D-fructose (AF) to 1,5-anhydro-D-glucitol (By similarity). Has low NADPH-dependent reductase activity towards 9,10-phenanthrenequinone (in vitro) (PubMed:12604216, PubMed:15118078). {ECO:0000250|UniProtKB:Q9DCT1, ECO:0000269|PubMed:12604216, ECO:0000269|PubMed:15118078}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | AKR1C3 | chr10:5139742 | chr10:4872867 | ENST00000380554 | + | 3 | 9 | 23_24 | 123.0 | 324.0 | Nucleotide binding | NADP |
Hgene | AKR1C3 | chr10:5144842 | chr10:4877867 | ENST00000380554 | + | 7 | 9 | 166_167 | 282.0 | 324.0 | Nucleotide binding | NADP |
Hgene | AKR1C3 | chr10:5144842 | chr10:4877867 | ENST00000380554 | + | 7 | 9 | 216_222 | 282.0 | 324.0 | Nucleotide binding | NADP |
Hgene | AKR1C3 | chr10:5144842 | chr10:4877867 | ENST00000380554 | + | 7 | 9 | 23_24 | 282.0 | 324.0 | Nucleotide binding | NADP |
Hgene | AKR1C3 | chr10:5144842 | chr10:4877867 | ENST00000380554 | + | 7 | 9 | 270_272 | 282.0 | 324.0 | Nucleotide binding | NADP |
Hgene | AKR1C3 | chr10:5144842 | chr10:4877867 | ENST00000380554 | + | 7 | 9 | 276_280 | 282.0 | 324.0 | Nucleotide binding | NADP |
Tgene | AKR1E2 | chr10:5139742 | chr10:4872867 | ENST00000298375 | 0 | 10 | 265_277 | 13.0 | 321.0 | Nucleotide binding | NADP | |
Tgene | AKR1E2 | chr10:5139742 | chr10:4872867 | ENST00000334019 | 0 | 8 | 265_277 | 13.0 | 264.0 | Nucleotide binding | NADP | |
Tgene | AKR1E2 | chr10:5139742 | chr10:4872867 | ENST00000345253 | 0 | 7 | 265_277 | 13.0 | 223.0 | Nucleotide binding | NADP | |
Tgene | AKR1E2 | chr10:5139742 | chr10:4872867 | ENST00000532248 | 0 | 7 | 265_277 | 13.0 | 251.0 | Nucleotide binding | NADP | |
Tgene | AKR1E2 | chr10:5144842 | chr10:4877867 | ENST00000298375 | 2 | 10 | 265_277 | 108.0 | 321.0 | Nucleotide binding | NADP | |
Tgene | AKR1E2 | chr10:5144842 | chr10:4877867 | ENST00000334019 | 2 | 8 | 265_277 | 108.0 | 264.0 | Nucleotide binding | NADP | |
Tgene | AKR1E2 | chr10:5144842 | chr10:4877867 | ENST00000345253 | 2 | 7 | 265_277 | 108.0 | 223.0 | Nucleotide binding | NADP | |
Tgene | AKR1E2 | chr10:5144842 | chr10:4877867 | ENST00000532248 | 2 | 7 | 265_277 | 108.0 | 251.0 | Nucleotide binding | NADP |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | AKR1C3 | chr10:5139742 | chr10:4872867 | ENST00000380554 | + | 3 | 9 | 166_167 | 123.0 | 324.0 | Nucleotide binding | NADP |
Hgene | AKR1C3 | chr10:5139742 | chr10:4872867 | ENST00000380554 | + | 3 | 9 | 216_222 | 123.0 | 324.0 | Nucleotide binding | NADP |
Hgene | AKR1C3 | chr10:5139742 | chr10:4872867 | ENST00000380554 | + | 3 | 9 | 270_272 | 123.0 | 324.0 | Nucleotide binding | NADP |
Hgene | AKR1C3 | chr10:5139742 | chr10:4872867 | ENST00000380554 | + | 3 | 9 | 276_280 | 123.0 | 324.0 | Nucleotide binding | NADP |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
Gene | STRING network |
AKR1C3 | |
AKR1E2 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to AKR1C3-AKR1E2 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to AKR1C3-AKR1E2 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |