UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:HNRNPA2B1-SKAP2 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: HNRNPA2B1-SKAP2 | FusionPDB ID: 37097 | FusionGDB2.0 ID: 37097 | Hgene | Tgene | Gene symbol | HNRNPA2B1 | SKAP2 | Gene ID | 3181 | 8935 |
Gene name | heterogeneous nuclear ribonucleoprotein A2/B1 | src kinase associated phosphoprotein 2 | |
Synonyms | HNRNPA2|HNRNPB1|HNRPA2|HNRPA2B1|HNRPB1|IBMPFD2|RNPA2|SNRPB1 | PRAP|RA70|SAPS|SCAP2|SKAP-HOM|SKAP55R | |
Cytomap | 7p15.2 | 7p15.2 | |
Type of gene | protein-coding | protein-coding | |
Description | heterogeneous nuclear ribonucleoproteins A2/B1HNRNPA2B1/MYC fusionepididymis secretory sperm binding proteinhnRNP A2 / hnRNP B1nuclear ribonucleoprotein particle A2 protein | src kinase-associated phosphoprotein 2Fyn-associated phosphoprotein SKAP55 homologuePyk2/RAFTK-associated proteinSKAP-55HOMSKAP55 homologretinoic acid-induced protein 70src family-associated phosphoprotein 2src kinase-associated phosphoprotein of 5 | |
Modification date | 20200314 | 20200313 | |
UniProtAcc | P22626 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000354667, ENST00000356674, ENST00000476233, | ENST00000345317, ENST00000539623, ENST00000489977, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 43 X 37 X 14=22274 | 10 X 9 X 7=630 |
# samples | 50 | 13 | |
** MAII score | log2(50/22274*10)=-5.47728875772656 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(13/630*10)=-2.27684020535882 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: HNRNPA2B1 [Title/Abstract] AND SKAP2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | HNRNPA2B1(26235467)-SKAP2(26729981), # samples:2 HNRNPA2B1(26232115)-SKAP2(26894509), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | HNRNPA2B1-SKAP2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. HNRNPA2B1-SKAP2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. HNRNPA2B1-SKAP2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. HNRNPA2B1-SKAP2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. HNRNPA2B1-SKAP2 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. HNRNPA2B1-SKAP2 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. HNRNPA2B1-SKAP2 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | HNRNPA2B1 | GO:0006397 | mRNA processing | 2557628 |
Hgene | HNRNPA2B1 | GO:0006406 | mRNA export from nucleus | 10567417 |
Hgene | HNRNPA2B1 | GO:0031053 | primary miRNA processing | 26321680 |
Hgene | HNRNPA2B1 | GO:0050658 | RNA transport | 17004321 |
Hgene | HNRNPA2B1 | GO:1990428 | miRNA transport | 24356509 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LUSC | TCGA-43-2578-01A | HNRNPA2B1 | chr7 | 26235467 | - | SKAP2 | chr7 | 26729981 | - |
ChimerDB4 | LUSC | TCGA-43-2578 | HNRNPA2B1 | chr7 | 26235467 | - | SKAP2 | chr7 | 26729981 | - |
ChimerDB4 | UCEC | TCGA-PG-A914-01A | HNRNPA2B1 | chr7 | 26232115 | - | SKAP2 | chr7 | 26894509 | - |
ChimerDB4 | UCEC | TCGA-PG-A914 | HNRNPA2B1 | chr7 | 26232114 | - | SKAP2 | chr7 | 26894509 | - |
ChimerDB4 | UCEC | TCGA-PG-A914 | HNRNPA2B1 | chr7 | 26232115 | - | SKAP2 | chr7 | 26894509 | - |
ChimerDB4 | UCEC | TCGA-PG-A914 | HNRNPA2B1 | chr7 | 26240192 | - | SKAP2 | chr7 | 26883756 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000354667 | HNRNPA2B1 | chr7 | 26235467 | - | ENST00000345317 | SKAP2 | chr7 | 26729981 | - | 3814 | 926 | 169 | 1209 | 346 |
ENST00000354667 | HNRNPA2B1 | chr7 | 26235467 | - | ENST00000539623 | SKAP2 | chr7 | 26729981 | - | 1447 | 926 | 169 | 1209 | 346 |
ENST00000356674 | HNRNPA2B1 | chr7 | 26235467 | - | ENST00000345317 | SKAP2 | chr7 | 26729981 | - | 3778 | 890 | 169 | 1173 | 334 |
ENST00000356674 | HNRNPA2B1 | chr7 | 26235467 | - | ENST00000539623 | SKAP2 | chr7 | 26729981 | - | 1411 | 890 | 169 | 1173 | 334 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000354667 | ENST00000345317 | HNRNPA2B1 | chr7 | 26235467 | - | SKAP2 | chr7 | 26729981 | - | 0.000272398 | 0.99972755 |
ENST00000354667 | ENST00000539623 | HNRNPA2B1 | chr7 | 26235467 | - | SKAP2 | chr7 | 26729981 | - | 0.000468384 | 0.9995316 |
ENST00000356674 | ENST00000345317 | HNRNPA2B1 | chr7 | 26235467 | - | SKAP2 | chr7 | 26729981 | - | 0.000306419 | 0.99969363 |
ENST00000356674 | ENST00000539623 | HNRNPA2B1 | chr7 | 26235467 | - | SKAP2 | chr7 | 26729981 | - | 0.000580346 | 0.9994197 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >37097_37097_1_HNRNPA2B1-SKAP2_HNRNPA2B1_chr7_26235467_ENST00000354667_SKAP2_chr7_26729981_ENST00000345317_length(amino acids)=346AA_BP=73 MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRV VEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGH NAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGEEEEDSAPVKVEEQRKMS -------------------------------------------------------------- >37097_37097_2_HNRNPA2B1-SKAP2_HNRNPA2B1_chr7_26235467_ENST00000354667_SKAP2_chr7_26729981_ENST00000539623_length(amino acids)=346AA_BP=73 MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRV VEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGH NAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGEEEEDSAPVKVEEQRKMS -------------------------------------------------------------- >37097_37097_3_HNRNPA2B1-SKAP2_HNRNPA2B1_chr7_26235467_ENST00000356674_SKAP2_chr7_26729981_ENST00000345317_length(amino acids)=334AA_BP=61 MEREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREES GKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE MQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGEEEEDSAPVKVEEQRKMSQDSVHHTSGDKS -------------------------------------------------------------- >37097_37097_4_HNRNPA2B1-SKAP2_HNRNPA2B1_chr7_26235467_ENST00000356674_SKAP2_chr7_26729981_ENST00000539623_length(amino acids)=334AA_BP=61 MEREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREES GKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE MQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGEEEEDSAPVKVEEQRKMSQDSVHHTSGDKS -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:26235467/chr7:26729981) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
HNRNPA2B1 | . |
FUNCTION: Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs, packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging plays a role in various processes such as transcription, pre-mRNA processing, RNA nuclear export, subcellular location, mRNA translation and stability of mature mRNAs (PubMed:19099192). Forms hnRNP particles with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Involved in transport of specific mRNAs to the cytoplasm in oligodendrocytes and neurons: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) or the A2RE11 (derivative 11 nucleotide oligonucleotide) sequence motifs present on some mRNAs, and promotes their transport to the cytoplasm (PubMed:10567417). Specifically binds single-stranded telomeric DNA sequences, protecting telomeric DNA repeat against endonuclease digestion (By similarity). Also binds other RNA molecules, such as primary miRNA (pri-miRNAs): acts as a nuclear 'reader' of the N6-methyladenosine (m6A) mark by specifically recognizing and binding a subset of nuclear m6A-containing pri-miRNAs. Binding to m6A-containing pri-miRNAs promotes pri-miRNA processing by enhancing binding of DGCR8 to pri-miRNA transcripts (PubMed:26321680). Involved in miRNA sorting into exosomes following sumoylation, possibly by binding (m6A)-containing pre-miRNAs (PubMed:24356509). Acts as a regulator of efficiency of mRNA splicing, possibly by binding to m6A-containing pre-mRNAs (PubMed:26321680). Plays also a role in the activation of the innate immune response (PubMed:31320558). Mechanistically, senses the presence of viral DNA in the nucleus, homodimerizes and is demethylated by JMJD6 (PubMed:31320558). In turn, translocates to the cytoplasm where it activates the TBK1-IRF3 pathway, leading to interferon alpha/beta production (PubMed:31320558). {ECO:0000250|UniProtKB:A7VJC2, ECO:0000269|PubMed:10567417, ECO:0000269|PubMed:24356509, ECO:0000269|PubMed:26321680, ECO:0000303|PubMed:19099192}.; FUNCTION: (Microbial infection) Involved in the transport of HIV-1 genomic RNA out of the nucleus, to the microtubule organizing center (MTOC), and then from the MTOC to the cytoplasm: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) sequence motifs present on HIV-1 genomic RNA, and promotes its transport. {ECO:0000269|PubMed:15294897, ECO:0000269|PubMed:17004321}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | HNRNPA2B1 | chr7:26235467 | chr7:26729981 | ENST00000354667 | - | 8 | 12 | 112_191 | 252.33333333333334 | 1115.3333333333333 | Domain | RRM 2 |
Hgene | HNRNPA2B1 | chr7:26235467 | chr7:26729981 | ENST00000354667 | - | 8 | 12 | 21_104 | 252.33333333333334 | 1115.3333333333333 | Domain | RRM 1 |
Hgene | HNRNPA2B1 | chr7:26235467 | chr7:26729981 | ENST00000356674 | - | 7 | 11 | 112_191 | 240.33333333333334 | 439.3333333333333 | Domain | RRM 2 |
Hgene | HNRNPA2B1 | chr7:26235467 | chr7:26729981 | ENST00000356674 | - | 7 | 11 | 21_104 | 240.33333333333334 | 439.3333333333333 | Domain | RRM 1 |
Hgene | HNRNPA2B1 | chr7:26235467 | chr7:26729981 | ENST00000354667 | - | 8 | 12 | 9_15 | 252.33333333333334 | 1115.3333333333333 | Motif | Nuclear localization signal |
Hgene | HNRNPA2B1 | chr7:26235467 | chr7:26729981 | ENST00000356674 | - | 7 | 11 | 9_15 | 240.33333333333334 | 439.3333333333333 | Motif | Nuclear localization signal |
Tgene | SKAP2 | chr7:26235467 | chr7:26729981 | ENST00000345317 | 8 | 13 | 297_358 | 265.3333333333333 | 1096.6666666666667 | Domain | SH3 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | HNRNPA2B1 | chr7:26235467 | chr7:26729981 | ENST00000354667 | - | 8 | 12 | 202_353 | 252.33333333333334 | 1115.3333333333333 | Compositional bias | Note=Gly-rich |
Hgene | HNRNPA2B1 | chr7:26235467 | chr7:26729981 | ENST00000356674 | - | 7 | 11 | 202_353 | 240.33333333333334 | 439.3333333333333 | Compositional bias | Note=Gly-rich |
Hgene | HNRNPA2B1 | chr7:26235467 | chr7:26729981 | ENST00000354667 | - | 8 | 12 | 193_353 | 252.33333333333334 | 1115.3333333333333 | Region | Low complexity (LC) region |
Hgene | HNRNPA2B1 | chr7:26235467 | chr7:26729981 | ENST00000354667 | - | 8 | 12 | 308_347 | 252.33333333333334 | 1115.3333333333333 | Region | Nuclear targeting sequence |
Hgene | HNRNPA2B1 | chr7:26235467 | chr7:26729981 | ENST00000356674 | - | 7 | 11 | 193_353 | 240.33333333333334 | 439.3333333333333 | Region | Low complexity (LC) region |
Hgene | HNRNPA2B1 | chr7:26235467 | chr7:26729981 | ENST00000356674 | - | 7 | 11 | 308_347 | 240.33333333333334 | 439.3333333333333 | Region | Nuclear targeting sequence |
Tgene | SKAP2 | chr7:26235467 | chr7:26729981 | ENST00000345317 | 8 | 13 | 116_219 | 265.3333333333333 | 1096.6666666666667 | Domain | PH | |
Tgene | SKAP2 | chr7:26235467 | chr7:26729981 | ENST00000345317 | 8 | 13 | 14_64 | 265.3333333333333 | 1096.6666666666667 | Region | Homodimerization |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
HNRNPA2B1 | |
SKAP2 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to HNRNPA2B1-SKAP2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to HNRNPA2B1-SKAP2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |